Split (1)

train · 8.57k rows

text stringlengths 784 300k
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1179 rating: +189+–x Local sign warning of Area-179's restricted status. Image taken 4 October 2006. The sign no longer stands. Item #: SCP-1179 Object Class: Keter Special Containment Procedures: SCP-1179 is apparently dormant, encased in the bedrock under Research Site-██. Apart from simple monitoring and standard research safety protocols, no additional containment is deemed necessary at this time. [Edited, 05/██/1962] Due to the subterranean nature, self-ambulatory capabilities, and physical properties of SCP-1179, enforcement of containment has to date proven impossible. Project Tartarus is charged with continuous research into developing additional practical containment measures for SCP-1179. It is speculated that SCP-1179 is capable of being destroyed, as wounds inflicted by heavy ordnance during the evacuation attempt of Expedition-1179-VI were later observed to not have healed. To date, isolation and observation of SCP-1179 has mostly proven sufficient, as SCP-1179 has demonstrated no efforts to move above ground and has limited itself to a roughly two kilometer radius from its original location of discovery. In the event that SCP-1179 should be observed to move beyond recorded areas, personnel are to immediately notify O5 Command. The land above SCP-1179 has been designated as “Area-179” by the Foundation. Due to the proximity of a civilian population center which cannot be moved, Area-179 is to only employ low yield nuclear failsafe devices. [Edited, ██/██/1992] The general public has become aware of SCP-1179 and believes the cover story that it is, in fact, an anthracite coal mine fire caused by a trash dump fire. Foundation personnel are to infiltrate and coordinate all efforts to extinguish the blaze for the protection of both involved civilians and SCP-1179. All efforts to extinguish the blaze have ceased. [Edited, ██/██/198█] Civilians living above SCP-1179 have suffered adverse health effects due to byproducts of the fire, including carbon monoxide, carbon dioxide, and insufficient oxygen levels. Civilians are no longer permitted in Area-179. [Edited, ██/██/1992] Effects on civilians are within tolerable levels, with the populace generally unaware of the scale of SCP-1179. Following the incident with Todd Domboski and the associated quantity of press coverage, the Foundation is to work to relocate civilians from Area-179. Area-179 has been claimed by the Commonwealth of Pennsylvania under eminent domain. [Edit, ██/██/1992] It has subsequently been closed to all unauthorized personnel with the Pennsylvania government enforcing evictions of unauthorized residents. [Edit, ██/██/ 2009] A bunker has been constructed in a geologically stable section of Area 179, allowing for Foundation operations in the area and monitoring of SCP-1179. Foundation security personnel, along with local law enforcement, are to coordinate to prevent civilians from entering Area 179, in accordance with warnings issued by the Pennsylvania Department of Environmental Protection. Personnel within Area 179 are to restrict their movement to approved areas, due to the geological instability caused by SCP-1179. Description: SCP-1179 has not been clearly and scientifically observed since May 1962 during Incident CB-1962-██-███. The original file description of SCP-1179 is as follows: SCP-1179 appears to be a giant vaguely humanoid figure carved from an unknown volcanic rock. In one hand, it holds a whip; in the other, a sword. Its face has vaguely human features, including a long beard, though it has two large horns like those of a ram flanking its face. SCP-1179 measures over 30 meters from head to toe, with shoulders over 8 meters wide. It resembles a carving of the Norse eld jötunn Surtr (the giant guarding the frontier of the Norse fire realm of Múspell). Dating of the stratum encasing SCP-1179 indicates it dates to the Mississippian subperiod of the Carboniferous period, approximately 359.2-318.1 million years ago. This age is consistent with the geological age of this region. SCP-1179 has since demonstrated the ability to change shape at will, and to become invisible and without form, appearing as a giant flying shade. Photographic evidence has failed to produce a conclusive image of SCP-1179, due to inexplicable camera feed disruptions, operator panic, and physical destruction of cameras. Expeditionary teams have described SCP-1179 as “having hellfire” for eyes and generally having great height. Its body often is seen as a combination of fire, smoke, and hardening lava. From there, the descriptions begin to diverge wildly. Survivors generally describe its head as “monstrous,” with some mentioning curved horns consistent with the original form of SCP-1179. Others argue it has fangs larger than a man's arm. Still others state that SCP-1179 has neither horns nor fangs, and its face is encircled by flames which reach down into a long beard of fire. Eyewitnesses cannot agree whether or not it has wings. Most agree that it is usually armed with a multi-tailed whip of flame and a glowing red sword of fire several meters in length, though it will at times appear with either the whip or the sword or neither. Though of great size, it is apparently capable of moving both quickly and quietly. Those few who survive encounters with SCP-1179 generally describe it as smelling of “rotten eggs and old chimneys”. Chemical analysis of air samples taken from SCP-1179’s breath have shown exceptionally high concentrations of carbon monoxide and sulfur dioxide. Item History: + Show Item History, 1871 to Present SCP-1179 was discovered in 1871, five years after anthracite coal mining was begun in the area. It was nicknamed the “sleeping stone giant”. The mine shaft in which it was discovered belonged to Mr. Sean O’Malley, a member of the Molly Maguires, an Irish- American secret society, whose members were predominantly coal miners in Pennsylvania. The society kept the sleeping stone giant hidden away, a closely-guarded secret. Though the Molly Maguires were dismantled in the late 1870s, the giant’s guardians managed to escape prosecution. The sleeping stone giant came to the attention of the Foundation in 192█, when operatives were conducting a routine background check into Prospective Agent Iain O’Malley (grandson of the original Mr. O’Malley). The land above the giant’s mine shaft was purchased by a Foundation front company and Research Site-██ was established. In May 1962, residents of the nearby town lit a trash fire in a landfill which had been created from an abandoned coal mine. Those responsible for garbage disposal followed insufficient safety protocols, and a seam of anthracite coal ignited. The seam was small and Foundation geologists have determined it would have burned out in approximately two years, had it not run under Research Site-██. The fire reached SCP-1179, which promptly reanimated in the presence of the fire. Upon reanimation, SCP-1179 killed all Foundation personnel at Research Site-██ and significantly damaged the site’s bunker. It subsequently retreated into the honeycomb of coal mines and caverns in the area, igniting subsequent anthracite coal fires. The mines, caverns, and surrounding countryside was designated Area-179, though due to the nearby town’s civilian population of several thousand individuals, standard Area construction protocols for Keter containment could not be observed; these were modified to fit the circumstance. Five separate Expeditionary Teams were sent in to capture SCP-1179 between 1962 and 1970, though none were successful. They did determine that SCP-1179 had proven capable of expanding the caverns to vast proportions and unknown depths. Satellite imagery and evidence of noxious gases and ground collapse contradict these accounts and the photographic evidence which confirms them, indicating that the mine fires are only burning in an area covering roughly 400 acres, or 1.62 square kilometers. The discrepancy between the sizes of the caverns has, to date, not been reconciled. In 1970, Foundation geologists determined that the subterranean fires caused by SCP-1179 would remain burning for in excess of 250 years. With Foundation personnel successful in perpetuating the half-truth of the original cause of the mine fires and unsuccessful both in recovering SCP-1179 for removal and transfer to an alternate location and extinguishing the blazes it had caused, the decision was made to instead relocate the nearby town. Concurrently, Project Tartarus was formally begun to develop and refine permanent special containment procedures for SCP-1179 and determine means to extinguish the anthracite fires. Foundation personnel have worked constantly in the area to ensure the continuation of the mine fire cover story and prevent civilians from encountering SCP-1179, though this proved increasingly difficult as the local situation continued to deteriorate. In 1981, twelve-year-old local, Tom Domboski, fell into a sinkhole approximately 1.25 meters wide by 46 meters deep which opened beneath his feet his backyard. He was saved by his cousin, 14-year-old Eric Wolfgang. The plume of hot steam billowing from the hole was measured as containing a lethal level of carbon monoxide, and chemical analysis matched the steam to samples of SCP-1179's breath. Spurred both by the worsening “mine fire” and by covert lobbying by Foundation political contacts, in 1984 the United States Congress allocated funds in excess of $42 million to relocate the civilian residents from the area. At the suggestion of under-cover Agent █████, Pennsylvania Governor Bob Casey claimed eminent domain on all properties in the borough, condemning all buildings within. Foundation personnel ensured that the subsequent legal effort by residents to have the decision reversed were met with failure. As a result, full Keter Area containment protocols could finally be observed. Addendum 1179-1: Research is pending into harnessing the anthracite coal fires as a means of energy production, as they will likely continue burning for the foreseeable future. See Project Vulcan’s Forge, or contact Project Lead Dr. Crane or Area-179 Director Wilson for further details. Addendum 1179-2: Images relating to SCP-1179's effects on Area-179. + Show Images Damage caused by SCP-1179 to former Pennsylvania Route 61. A hillside in Area-179 which has collapsed due to SCP-1179. Noxious gases rising from a sinkhole in Area-179; chemical analysis suggests some of these were the breath of SCP-1179. « SCP-1178 \| SCP-1179 \| SCP-1180 » _ccautonomousfirehostilehumanoidketerlocationscpsculpture page revision: 17, last edited: 01 Oct 2022 06:57 Edit Rate (+189) Tags Discuss (52) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-118 rating: +278+–x Picture from containment failure in Red Zone █, 19██ Item #: SCP-118 Object Class: Euclid Special Containment Procedures: Due to the number and distribution of SCP-118, containment of every specimen is impossible. Known SCP-118 Red Zones are to be closed off to all civilian marine vessels and divers under the guise of a military presence or other plausible cover story. Contacts in navies known to operate near SCP-118 Red Zones are to be utilized in order to minimize the passage of military vessels through the Red Zones. If any area within the Red Zone has a depth of less than 1500 meters, the restriction is to be applied to aircraft as well. All human activity in surrounding Yellow Zones is to be monitored, and any non-military vessels or individuals approaching the Red Zone are to be turned away. In the Red and Yellow Zones, protocol TOXIC HARVEST is to be followed to ensure the removal of devices generated by SCP-118. Furthermore, protocol CELL WATCH is to be followed to ensure the early detection of any emerging Red Zones. Samples of SCP-118 can be stored using standard containment procedures for non- virulent anomalous microbes. Description: SCP-118 is a species of ocean-dwelling protista that is capable of assembling functional, self initiating, nuclear devices from materials present in ocean water. While SCP-118 is unknown and hence has not been classified by the scientific community, specimens resemble protists of the phylum Euglenophyta but have significantly increased levels of movement speed, nutrient storage capability and resistance to alpha radiation. Specimens of SCP-118 have been found in all of the world's oceans and seas. When in a survivable salt water environment, specimens of SCP-118 will seek out materials including but not limited to iron, silver, copper, carbon, TNT, and uranium isotopes. When SCP-118 has located a material of interest the material is absorbed into the cell using a method dependent on the size of the material. Single atoms and molecules (mostly substances that are dissolved in the water) are passed through the cellular membrane through specialized protein pumps. Larger particles smaller than the cell itself are ingested through phagocytosis. Larger pieces will have particles torn off through an unknown mechanism, which are then absorbed using the first two methods. This "mining" occurs even in solid and hard substances, such as metal ingots. Upon reaching a threshold of absorbed materials, specimens of SCP-118 will move towards an "assembly area" on the bottom of the body of the water they are present in and will contribute to the assembly of a nuclear device. The nuclear devices assembled are gun-type fission devices using Uranium-235 as their fissile material. Observation of devices in the process of being assembled show that the process starts with the assembly of a metallic rounded cylindrical casing for the device, followed by the creation of two sub-critical masses of uranium and the conventional explosives to propel them into each other. The mechanism by which SCP-118 enriches harvested uranium is currently unknown. (See Addendum 4). The device is then finished with the assembly of a Uranium-238 tamper where the two uranium masses will collide and the assembly of a trigger mechanism. SCP-118 appears to assemble the necessary components by adding minuscule amounts of material to an (initially) tiny material "seed". Differing atoms and molecules can be added to the same component and assembled components are not necessarily homogeneous. It is currently unknown whether SCP-118 builds on the seed atom by atom or by adding very small sub-micrometer fragments. The mechanism by which SCP-118 attaches new material to the seed seamlessly is unknown. The assembly time depends on the size of the device being assembled, water conditions and mineral availability but observations suggest that 300 days for a medium size device can be considered average. Once a nuclear device is finished SCP-118 will detonate the device by completing a circuit in the trigger mechanism. Around 90% of the nuclear explosions recorded as a result of SCP-118 have had yields in the 20 to 35 kiloton range, although yields as low as 4 kilotons and up to ███ kilotons have been reported. Aside from cases involving human interference, failure to detonate has never been observed, as all nuclear devices recorded have either been detonated of their own accord or removed from the water prior to completion. Devices constructed by SCP-118 appear to be larger than man- made devices of similar design and yield, presumably due to the neutron moderating effect of the water that separates the uranium masses throughout much of the device's construction. A given assembly area typically has between one and three devices in the process of assembly at any given time, although as many as six at a time has been observed. In zones where multiple devices are being simultaneously assembled, the devices are separated by enough distance to prevent the detonation of one from destroying or setting off the other(s). While the Foundation is unable to prevent civilians and other organizations from obtaining samples of SCP-118, its superficial similarity to existing species, few numbers (relative to all oceanic protista), lack of anomalous behavior outside material rich bodies of water, and the Foundation's standard monitoring of scientific studies at risk of uncovering information about anomalous biological species ensures that the chance of SCP-118's true nature being determined through cell samples is minimal. There are currently six different active SCP-118 assembly areas known to the Foundation. While the natural disappearance of an assembly area has been observed, the current consensus among researchers assigned to SCP-118 is that elimination of assembly areas without massively noticeable effects is currently unfeasible (See Experiment Log 118 - Gamma for details). Thus, containment is to be established at SCP-118's assembly areas, to be designated "Red Zones", and surrounding "Yellow Zones". Furthermore, areas with elevated concentrations of SCP-118, "Zones of Interest", are to be monitored for signs of assembly areas. + List of Containment Zones - Level 4 clearance required Red Zones: RZ - 1 Location: Mid-Atlantic Coordinates: [REDACTED] Zone commander: Captain Romanov Note: USS ████████ Incident occurred ██ km outside this Red Zone. RZ - 2 Location: North Pacific Coordinates: [REDACTED] Zone commander: Captain Chambers RZ - 4 Location: South Pacific Coordinates: [REDACTED] Zone commander: Captain Knapp RZ -5 Location: Indian Ocean Coordinates: [REDACTED] Zone commander: Captain Wayne Note: Proximity to shipping lanes reduces tolerance for nuclear explosions RZ - 6 Location: North Atlantic Coordinates: [REDACTED] Zone commander: Captain Fazil Note: Proximity to US SOSUS hydrophones reduces tolerance for nuclear explosions. RZ - 7 Location: [REDACTED] Coordinates: [REDACTED] Zone commander: Captain ████████ Note: Red Zone lies within ████████ city limits. This, combined with the shallow average depth of Red Zone, the heavy shipping traffic in the area, the ongoing tensions between ██████ and ██████, a nuclear power, and the presence of Foundation personnel and facilities in the city makes a nuclear detonation in this Red Zone unacceptable. In addition, heavy ship traffic through the area and heavy air traffic above the city make restricting access for any long period of time impractical. Zones of Interest (ZOI) ZOI - 1 (█████ N, █████ E) - SCP-118 levels increasing around %5 per year, ZOI area growing approximately %3 per year ZOI - 3 (█████ N, █████ W) - ZOI covers approximately 20 oil wells, SCP-118 levels and ZOI size currently stable. Former Zones (FZ) FZ-RZ-3 (█████ N, █████ E) - Formerly RZ - 3, Last device assembled in 1992, SCP-118 levels dropped to average oceanic values in 20██ FZ-ZOI-2 (█████ N, █████ W) - Formerly ZOI - 2, SCP-118 levels dropped to average oceanic values in 1986. Addendum-118-1: Following the USS ████████ Incident, the exclusion radius used when drawing red zones had been increased. Containment protocol TOXIC HARVEST has been updated. Addendum-118-2: With the signing of the Partial Test Ban Treaty and growing number and capability of nuclear detonation detection methods in use, the consequences of nuclear detonations caused by SCP-118 have increased. Containment protocols have been revised in light of these facts. Addendum-118-3: Due to the significant cost of containing SCP-118 Red Zones, the O-5 council has requested trials on possible methods to eliminate SCP-118 assembly areas. + Experiment Log 118-Gamma - Level 4 clearance required Introduction: Researchers with access to the files on SCP-118 are allowed to submit proposals to eradicate an SCP-118 assembly area with acceptable levels of collateral damage. The ones approved by TOXIC HARVEST command and the O5 council will be carried out. Trials are to be performed in Red Zone █. Proposal: Sterilization of unfinished nuclear device and immediate surroundings using a UV light emitter. Approval: Approved Result: Area around unfinished warhead initially free of micro-organisms, however SCP-118 concentration returned to normal levels within an hour. Non-sustained sterilization of sites seems ineffectual. Any method we come up with will have to keep the Red Zone, or at least the sea floor of it, free of SCP-118 for an extended period of time. -Dr Brant Proposal: Sodium Hypochlorite pumped to ocean floor. Approval: Denied Result: N/A The chemicals will disperse too much to be effective. Any amount sufficient to reduce SCP-118's numbers will cause massive ecological damage. -Dr Klaus Proposal: Depth charge bombardment of ocean floor to break up under- assembly devices Approval: Denied Result: N/A Aside from the fact this would break our naval budget, the chances of triggering the conventional explosive in the devices and causing a "fizzle" is too high. It would also make our activities even more detectable with hydrophones. -Dr Klaus Proposal: "Sweeping" of ocean using a Cobalt-60 powered directional gamma ray emitter. Approval: Approved Result: While procedure resulted in the sterilization of "swept" area, procedure was far too slow to sterilize entire Red Zone before specimens returned. Keeping entire Red Zone sterile would require impractical numbers of emitters and vessels. While it's a shame the device can not get rid of the Red Zones for us, I think it can be of use to our device recovery teams. The gamma rays can sterilize the devices we recover to prevent undesired detonations during the recovery of almost complete devices. The gamma rays can also penetrate into areas where our current chemical and UV sterilization methods can't reach - Captain Thomson (RZ-3 Zone Commander) Proposal: A plastic membrane to block access to ocean floor at Red Zone Approval: Proof of concept on one under-assembly warhead approved Result: First attempt was unable to acquire a water-tight seal around warhead. Membrane in second attempt was too fragile for ocean conditions and was torn off its moors. Third membrane, manufactured using a thicker and sturdier design, had hundreds of micro tears ripped in it within hours, possibly due to SCP-118's "mining" action. Not surprising, considering that SCP-118 has been known to wear through the casings of old artillery shells to harvest the explosives within. We had hoped that cutting off the assembly area would work better than cutting off the raw materials. -Dr. Klaus Proposal: Compound ██████ pumped to ocean floor. Note: Proposed by Dr. ██████████, former researcher for SCP-118 currently working at Bio Research Site ██'s Chemical Research Division. Tests confirm that compound is lethal to SCP-118, remains concentrated at bottom of water, and degrades into relatively harmless chemicals in water over a period of 15 hours. Approval: Approved Result: Over one week, SCP-118 concentrations on ocean floor fell to 3% of previous levels. No signs of progress observed on two known uncompleted nuclear devices in Red Zone. However, 100 days after the start of the experiment an under assembly nuclear device was detected 60 km North of the Red Zone. Measurements in the area indicated vastly elevated levels of SCP-118 and the area around discovery was reclassified as a Red Zone. Furthermore, the unexpected breakdown of Compound ██████ by certain species of oceanic bacteria resulted in toxic byproducts that caused a noticeable die-off of fish in treated zone. Upon stoppage of experiment Red Zone was observed to gradually "migrate" back to former location. It seems that making a Red Zone non-viable served only to move SCP-118's assembly areas to a new location. Nevertheless, perhaps if we can improve Compound ██████ or find a new one whose application is more subtle we can move Red Zones into areas away from areas of human habitation or commercial activity. -Dr. ██████████ Proposal: Use of SCP-████ via ████████████████████████████████████. Approval: Denied Result: N/A SCP-████ has classified properties that preclude its use in such a manner. -O5-5 Conclusion: Due to increased media attention to areas around Red Zone █ due to aftermath of the application of Compound ██████ and the lack of proposals without high risks of substantial collateral damage, testing in Red Zone █ has been suspended. Addendum-118-4 (Level 4 Clearance required): Our research has determined SCP-118 enriches uranium by exploiting the fact that U-235 has a slightly greater preference for a high oxidation state than U-238. SCP-118 specimens which have harvested large amounts of uranium and are near assembly areas appear to develop specialized organelles resembling a series of thousands of vacuole-like chambers with mitochondria-like organelles within them, responsible for catalyzing reduction and oxidation reactions. In a given chamber, uranium is repeatedly reduced and oxidized. Compounds with uranium in higher oxidation states are transferred up the "chain" of chambers while compounds with lower oxidation states are transferred down the chain. This results in a small amount of highly enriched uranium at the very end of the chain. Researchers and engineers at Research Sector █ have managed to create a prototype uranium enrichment device based on the principles employed by SCP-118. While the prototype was unable to produce weapons-grade uranium without using unreasonable amounts of time, it was successful in producing reactor-grade uranium, albeit at significantly greater cost than conventional methods. Despite its current limitations, the idea shows promise and I have forwarded our findings to the relevant front companies. -Dr. ████████ « SCP-117 \| SCP-118 \| SCP-119 » ‡ Licensing / Citation Cite this page as: "SCP-118" by Oksbad, from the SCP Wiki. Source: https://scpwiki.com/ scp-118. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. Filename: SCP118Pic.jpg Name: Nuclear depth charge explodes near USS Agerholm (DD-826), 11 May 1962.jpg Author: US Naval Historical Center License: Public Domain Source Link: Wikimedia _cc_licenseboxaliveaquaticeuclidmicroscopicscpself-replicatingspecies page revision: 61, last edited: 19 Oct 2022 16:10 Edit Rate (+278) Tags Discuss (55) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1180 rating: +203+–x SCP-1180 before transplant Item #: SCP-1180 Object Class: Safe Special Containment Procedures: A security camera has been mounted near the transplantation site; footage should be reviewed for changes on a weekly basis. Hardhats are mandatory for those working in close proximity to SCP-1180. All instances of fallen or new growths should be promptly reported to the head of Botanical Research. Description: SCP-1180 is identical in appearance to Cocos nucifera, the coconut palm. The anomaly was discovered when a research team was dispatched to investigate local rumors of a "possessed palm": witnesses claimed that the plant would intentionally drop its sizable drupes on the heads of unsuspecting passersby. The specimen was found growing in relative isolation on a strip of shore less than 16km from the outer perimeter of Research Sector-09. SCP-1180 grows and fruits at the same rate as a comparable specimen of Cocos nucifera. The organism's only outwardly anomalous trait is a rattling or knocking sound that emanates from its fruits. These noises grow louder as the drupes reach maturity. Radiography results are identical to those of normal coconuts. Tests with human subjects suggest that the organism is equipped with an unusual adaption for preservation and propagation; while the tree itself is vulnerable to damage, subjects instructed to open, crack, or otherwise damage its offspring experience significant emotional distress. Addendum 7/29/██: excerpt from Agent Gast's recovery log: Research team, equipped with suitable headgear, meets with no accidents while examining the organism. A subdued rattling, described by recovery team as "knocking sounds", can be heard issuing from inside the ripening coconuts. Excavated root ball densely packed with worms of an unknown species. Several days of observation have yielded similar results; decision made to transplant the palm to Sector-09 grounds for further tests. Transplant accomplished without mishap. Addendum 8/9/██ ACCESS RESTRICTED TO LEVEL 3 PERSONNEL OR HIGHER +Experiment Log 8/7-14/██ Synopsis: Subjects are provided with tools and instructed to remove the husk of a coconut (designated SCP-1180-01) recently cut from SCP-1180. Majority visibly distressed by the knocking sounds from within. Several describe a feeling of horror; a few describe empathetic feelings— always with the desire to remove the object "outside". During sixth consecutive test, D-3767 (a subject with exceptionally low empathy scores) finally succeeds in rupturing and peeling away the husk; no immediate adverse effects observed. 8/7/██ 14:00 After removing husk, subject seems reluctant to crack open the shell. The rattling has grown perceivably louder, sometimes slowing almost to a stop before beginning again with renewed violence. The subject claims to "feel" the vibrations of the knocking, and claims that SCP-1180-3 has a "face". Subject refuses to remain in the same room with the object; eventually subdued and removed for observation. 16:00 Other subjects are instructed to photograph and describe their reactions to de-husked specimen; all react with similar displays of reluctance and increasing uneasiness. D-8084, another subject with significantly low empathy scores, instructed to crack open the already de-husked SCP-1180-3. Suitable precautions are taken by observing research team. Using a hammer, D-8084 manages to split the fruit open, cracking it into several large pieces. The white "meat" appears slightly rotten; kernel is otherwise empty. 8/8/██ 01:34 New growths have appeared on SCP-1180, apparently in place of those removed for testing. None of these specimens have been observed to "rattle". De-husked specimen 8/9/██ 04:50 D-8084's body discovered standing rigidly upright in the center of his cell. The corpse had been decapitated; site of injury is wrinkled and puckered, cause of trauma undetermined. Head of D-8084 not yet recovered. Addendum 8/14/██: The largest instance of the new growths, designated SCP-1180-8, now measures 110mm in diameter. Caretakers have reported knocking sounds coming from inside the husk. « SCP-1179 \| SCP-1180 \| SCP-1181 » _ccalivefeaturedplantsafescpspecies page revision: 40, last edited: 08 Aug 2022 07:12 Edit Rate (+203) Tags Discuss (41) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1181 rating: +31+–x Item #: SCP-1181 Object Class: Safe Special Containment Procedures: Site-916 is situated 100 meters from the northern edge of SCP-1181. Patrol teams monitor the perimeter of SCP-1181 and any civilians that come near the perimeter of SCP-1181 are to be escorted away by personnel posing as game preserve rangers. An ultrasonic deterrent device is to remain active near the center of SCP-1181, to prevent activation. The device's full strength range is 300 meters, and weakens until ineffectual at 500 meters. The ultrasonic deterrent and its backup generator is to have daily maintenance checks to ensure it is functioning properly. All staff working within the range of the ultrasonic deterrent are to be equipped with sound negating equipment. Site-916 also contains SCP-1181-1, which is kept in secure containment room 916-4, for low risk objects. Access to SCP-1181-1 is restricted to level 4 personnel and above. Description: SCP-1181 is a circular clearing 2048 meters in diameter in a forest, located in a game preserve in [REDACTED]. When a living animal, or portion of a living animal, passes through the center of SCP-1181, SCP-1181 and its barrier activates. No other animal will be able to pass into SCP-1181 from the outside and any other animal inside SCP-1181 when it is activated will not be able to leave, until SCP-1181 is deactivated. The outside of the barrier of SCP-1181 is impenetrable until SCP-1181 is deactivated. The barrier is a sphere, surrounding SCP-1181. The barrier cannot be sensed, except by touch; the sensation is described as similar to touching cold glass. It also cannot be detected by any known instruments. Any objects present on the perimeter when SCP-1181 is activated will be split apart either side of the perimeter. Once the activator moves a random distance between 2 and 8 meters from the center of SCP-1181, 3 other exact copies of the activator will appear around the center of SCP-1181, facing outwards from the center, arranged equally separate from each other, 90 degrees apart. Each of the 3 copies will move identically to the activator. If the activator continues to move away from the center, it and its copies will be copied again at random distances from the center. The three additional copies will appear around a point 1 meter behind the activator or copy. Should any simultaneously created copies occupy the same space, their bodies will be fused together. Usually the fusing results in rapid expiration of these copies. If a newly created copy occupies the space of the activator or an already existing copy, the newly created copy will be spawned missing the portions of their body where the existing occupant of the space was, usually resulting in quick, if not instantaneous, death from blood loss. Living fused and/or mutilated copies and copies that block each others' paths will still attempt to the best of their ability to mimic the activators movements. If the activator or its copies touches the inside of the barrier of SCP-1181 they will begin to combust. If the person or a copy on fire is copied they will spawn copies that are also aflame. Tests with D-Class personnel asked to touch and describe the physical texture of the inside of the barrier have so far been inconclusive. SCP-1181 will deactivate if the activator passes through the center point a second time, or dies. Should the activator die, they, all their copies, and any remains will disappear. Should the subject pass through the center for a second time, all copies, and any remains of the copies, will disappear, and any injuries the activator sustained will be healed. Recovery Log SCP-1181 came to the Foundation's attention when a local hunter reported a 'swarm of butterflies, thick as a cloud' in the preserve. When the barrier was discovered, temporary containment protocol 76-Cherry was initiated. The swarm was monitored for several days by Foundation personnel, before it disappeared. Upon discovery that the barrier had disappeared along with the swarm, the area was investigated. During the investigation Agent Havelock activated SCP-1181 and died shortly after. Following this incident, Site-916 was built, permanent containment protocols put in place, and research into SCP-1181 commenced. Four weeks after the completion of Site-916, SCP-1181-1 was found during a regular patrol of SCP-1181's perimeter. + Test A - Date 27/7/████ Subject: D-Class-1033 Procedure: D-1033 was asked to walk in a straight line from point A, on one side of SCP-1181, through the center of SCP-1181, to point B, opposite side of of SCP-1181, and not stop for any reason. D-1033 would be the only subject present in SCP-1181. A UAV fitted with a video camera would record the test from above. Results: When D-1033 passed through the center, SCP-1181's barrier activated. Once D-1033 had walked 5 meters past the center of SCP-1181, 3 copies appeared around the center of SCP-1181, at 90 degree intervals. The subject did not notice the copies. When D-1033 had walked 17 meters past the center, he and the other three copies of himself manifested 3 additional copies. The subject turned and noticed the copies of himself which caused him to panic, he and his copies screamed and ran toward point B, despite warnings to remain at a walking pace. The 4 copies that had spawned facing backwards ran toward the center of SCP-1181. When the copies came into contact with each other they attempted to mimic D-1033 movements further, despite physically obstructing each other to the point of futility. As D-1033 continued toward point B, he activated several copying points. When the subject was 300 meters from the center of SCP-1181 there were over 16 thousand copies, some fused or otherwise mutilated. Uninjured copies continued to run in various directions, mimicking the subject. Immediately after D-1033 had passed the 500 meter from the center, there were over 60 thousand copies, interfering with each others progress, and spawning more copies. At this point much of the ground was covered with fused and mutilated corpses, as well as blood. Copies continued to mimic D-1033 and spawn more copies, or attempt to despite impediments and/or injury. When the subject arrived at point B, he and all copies of himself yelled; "Yes, finally!" As D-1033 and all copies which came into contact with the perimeter, they burst into flame, screaming and rolling around. All other living copies rolled and screamed regardless of if they were on fire. Seven minutes after coming into contact with the perimeter the subject died from third degree burns. The extensiveness of these burns was not able to be verified. The subject and all copies disappeared, including blood, organs and smoke. SCP-1181 and its barrier deactivated. + Test B - Date 13/8/████ Subject: D-Class-1059 Procedure: The subject was told to walk in a straight line from point A, on one side of SCP-1181, through the center of SCP-1181, to point B, 20 meters from the center, then turn and head back through the center to point C, 5 meters from the center. The subject would wait at point C for 10 minutes, then walk through the center of SCP-1181 again toward point D, 500 meters from center, then turn around and return to the center of SCP-1181. D-1059 was told not stop for any reason. D-1059 would be the only subject present in SCP-1181. The subject was informed of the clearing's nature prior to the test to lessen the chance of panic during the test. A UAV fitted with a video camera would record the test from above. Results: After activating SCP-1181, D-1059 moved to point B; being forewarned, she did not panic when she saw the copies of herself, although she was visibly startled. The subject then turned and walked towards the center of SCP-1181. 2 meters from the center, D-1059 began to struggle through the scrum of her copies as she made her way to the center. After two minutes, all the copies of D-1059 disappeared. SCP-1181 deactivated. D-1059 was seen crawling towards point C, where she waited for ten minutes, before walking through the center point, towards point D, reactivating SCP-1181. Upon reaching point D, the subject turned and headed toward the center of SCP-1181. Once D-1059 was 250 meters from the center of SCP-1181, she ran into resistance from her copies, and her progress towards the center slowed. Five minutes later, visual confirmation of D-1059 was lost in a pile of bodies 50 meters from the center. Four minutes later, D-1059 and all her clones disappeared, and SCP-1181 deactivated. D-1059 presumed suffocated. + Analysis of Tests Study of the UAV recordings of subjects interacting within SCP-1181 show SCP-1181's radial symmetry. Any one quarter of SCP-1181 is identical to the other three, no matter how many copies there are or how they are moving, despite mutilation, pile-ups, blood etc. So far it seems that nothing can be done by the subject interacting with SCP-1181 to ruin SCP-1181's perfect symmetry. + Analysis of SCP-1181-1 Description: SCP-1181-1 is a large stone tablet with an inscription chiseled into it. The type of rock was consistent with local geology. The language of the inscription is not known. Decoded Inscription For such a thing to be created, without means to destroy it, it can only be unforgiving maliciousness, unforgivable stupidity, or perhaps both. I will never know. The symmetrical plague enveloped the planet, but for the mountains, valleys and seas, each hemisphere an identical wedge of swarming [REDACTED], with the source as its polar center. The source, only a point in space, with nothing to identify it, or give warning. The planet was abandoned. But there was nowhere to go, and the cold cradle of black space could not be our home. In our calm, silent despair, we elected to spend our last days in the pursuit of a hope. A hope that was both for ourselves, and not for ourselves. With what was salvaged, we did what we could. May this barrier serve you well, or God help you. « SCP-1180 \| SCP-1181 \| SCP-1182 » ‡ Licensing / Citation Cite this page as: "SCP-1181" by SwamplessThing, from the SCP Wiki. Source: https:// scpwiki.com/scp-1181. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxectoentropiclocationsafescpself-replicating page revision: 25, last edited: 21 Oct 2022 08:20 Edit Rate (+31) Tags Discuss (49) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1182 rating: +163+–x Item #: SCP-1182 Object Class: Safe Special Containment Procedures: SCP-1182 is essentially harmless and as such is to be contained in a standard locker. Because of the object’s unique mental effects, usage of it is not permitted unless at least one Level 2/1182 clearance staff member is present. Description: SCP-1182 is a small octopus sculpture approximately 171 mm in length and 76 mm in breadth, weighing 312 grams. It is constructed from a combination of wire, copper, and titanium alloy. The head of the octopus contains a clockwork contraption that serves no documented purpose. When held by a subject (who will henceforth be referred to as SCP-1182-1), SCP-1182 and SCP-1182-1 become effectively invisible. SCP-1182 causes the subject to camouflage perfectly with their surroundings. The sculpture causes an as of yet unexplained reaction on SCP-1182-1’s pigmentation, giving it the properties of an octopus in disguise. This also means that the subject can only achieve full invisibility while naked, as the effect does not extend to clothing. The camouflage is distinctly much better than that of a common octopus, as SCP-1182-1 blends in to the point where it is impossible to distinguish their position. If SCP-1182 is released, the subject appears to “blink” back into existence. Of note is the mental effect that the octopus has on SCP-1182-1. While holding SCP-1182, the subject perceives the room as if it were filled completely with water. The presence of sea life from fish to coral to sea vegetation has been reported in all cases. Other personnel in the room are seen behaving as if submerged. Conversation with SCP-1182-1 is impossible as the subject hears only gurgling noises as if the speaker were communicating underwater. When SCP-1182-1 moves, they feel as though they are swimming. In three cases, SCP-1182-1 reported seeing their limbs as the tentacles of an octopus. SCP-1182’s effects, both the camouflage and the hallucinations, only work if the octopus is in contact with a subject’s skin. Tests involving holding the object through a glove and similar materials have yielded no results. « SCP-1181 \| SCP-1182 \| SCP-1183 » ‡ Licensing / Citation Cite this page as: "SCP-1182" by CthulhuBear, from the SCP Wiki. Source: https://scpwiki.com/ scp-1182. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxcephalopodclockworkhallucinationsafescpsculpturesensoryvisual page revision: 18, last edited: 21 Oct 2022 08:06 Edit Rate (+163) Tags Discuss (41) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1183 rating: +191+–x SCP-1183 after manifesting bison skulls on ██/██/18██. Item #: SCP-1183 Object Class: Euclid Special Containment Procedures: The airspace in a 25km radius around SCP-1183 is designated a no-fly zone. Any unauthorized aircraft or seagoing vessels entering this radius are to be informed that they are entering a military exclusion zone and rerouted. Aircraft or vessels which do not heed this warning are to be intercepted and detained. The affected area of SCP-1183 itself is not to be entered within two hours of its expected manifestation events. Observers are to promptly report each new manifestation. If manifested objects present a significant threat to health or safety and cannot be contained, site personnel are to evacuate to sea until the next manifestation occurs. Personnel are not to consume food or beverages manifested by SCP-1183. Description: SCP-1183 is a remote island in the south Pacific, 18km long by 8km wide, located at coordinates ██°██.█′S ███°██.█′W. Every 126 hours and 14 minutes, SCP-1183 manifests a pile of objects covering up to 85% of its surface. The objects appear instantaneously and silently, and all objects remaining from the previous manifestation simultaneously vanish. The area of SCP-1183 covered by the objects changes from manifestation to manifestation, and freshly-uncovered areas possess low vegetation consistent with local ecology. The manifested objects always belong to a single class. The breadth of these classes varies somewhat, such as the ██/██/████ manifestation of laptop computers of all makes and models, and the subsequent ██/██/████ manifestation of Apple MacBook Pro laptop computers, but in no case has the class been so narrow that it was difficult to determine its identity. For small classes with a few well-known individual instances, the manifested objects have always been observed to include every instance of that object class which is known to have existed. For more numerous objects, it is impossible to determine exact numbers, but estimates of the number of objects on SCP-1183 generally agree closely with estimates of the number of such objects to have ever existed. Of the ████ manifestations recorded by the Foundation to date, 76% have been man- made objects, and 16% have consisted of human or animal body parts. Objects manifested by SCP-1183 appear normal in every way while they remain, and man-made objects appear in like-new, ready-to-use condition. This is true even for objects known to have been completely destroyed or, in the case of spacecraft, sent elsewhere in the solar system. No living organisms have been observed to manifest. Selected Observations: Date: ██/██/████ Objects Observed: Bibles Notes: Due to the wide variation in sizes of individual copies, estimates of the number of Bibles present ranged from 3 billion to 6 billion. The pile was searched for early copies of potential historical significance, but given the number of copies present an exhaustive search was not possible. The earliest copy located dated to 1607. Date: ██/██/████ Objects Observed: Coca-Cola brand soft drink cans Notes: An estimated 1 billion cans of Coca-Cola brand soft drink, in a large conical pile with a maximum height of approximately 60m. Laboratory mice given only this soda to drink showed no ill effects until the next manifestation, after which they quickly expired. Based on this result, eating or drinking materials manifested by SCP-1183 is prohibited. Date: ██/██/████ Objects Observed: Saturn V launch vehicles Notes: All 15 flight-ready Saturn V launch vehicles observed lying side by side on the ground, fully assembled and fueled. The vehicles were extremely cold due to cryogenic fuel, and SCP-1183 was evacuated after initial investigation due to concern of a potential explosion. Date: ██/██/████ Objects Observed: Human left ears Notes: An estimated 1,200,000kg of left ears are present, representing approximately 60 billion individuals and covering 30% of the island to a maximum depth of 12m. Ears were initially warm and showed no sign of decay, but decay progressed normally until their disappearance. DNA analysis found normal human DNA representing individuals of a variety of races. Date: ██/██/████ Objects Observed: Unknown Notes: The previous manifestation disappeared as expected, but no new manifestation was discovered. It has been suggested that a manifestation may have in fact occurred, but the object or objects were small enough or inconspicuous enough to have escaped notice. Date: ██/██/████ Objects Observed: British castles Notes: Every known British castle was represented, along with five unknown castles which may represent previously-destroyed instances. The castles were arranged haphazardly within the affected area, but were situated upright and on the ground. Furnishings were not present. Date: ██/██/████ Objects Observed: Croissants Notes: A pile of croissants 80m high at its highest point, covering 6 square kilometers of SCP-1183. Estimating the number of croissants was complicated by the presumed heavy compression of the lower layers by the weight of the upper layers, but the average of the estimates was 126 billion croissants. Date: ██/██/████ Objects Observed: SCP objects possessing or relating to [REDACTED] abilities Notes: Eighteen seemingly-unrelated objects appeared. Several of the objects were immediately identified as SCP objects, all related to [REDACTED], and SCP-1183 was promptly evacuated. Due to the danger involved, the manifested objects were not tested to see if they retained the anomalous abilities of the originals. Using photographs of the objects taken prior to evacuation, seven of the objects were matched against SCP objects in Foundation custody. The remaining eleven objects may represent SCP objects to which SCP-1183's researchers do not have clearance to access, or they may represent objects which are not currently in Foundation custody. As the potential for eleven uncontained objects possessing [REDACTED] abilities represents a significant threat, photographs of these objects have been forwarded to a Level 4 review team for further evaluation. « SCP-1182 \| SCP-1183 \| SCP-1184 » _ccectoentropiceuclidhistoricalislandlocationscp page revision: 13, last edited: 31 Jul 2023 17:52 Edit Rate (+191) Tags Discuss (57) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1184 rating: +356+–x Item #: SCP-1184 Object Class: Safe Special Containment Procedures: SCP-1184 is stored in a secure locker at Site ██. Access to SCP-1184 requires Level 4 Level 5 authorization and a complete test script. While SCP-1184 is in use, no fewer than two armed guards wearing purpose-built soundproof headgear with an external audio feed and recording hardware, and thus able to hear the test without being subject to SCP-1184's effects, will monitor the test to ensure that the script is followed. Any deviation from the script will result in detainment or termination. Description: SCP-1184 appears to be a simple gold ring in the style of a wedding band and engraved with the word "Veritas" (the Latin word for "truth") on the inside of the band. SCP-1184 has an unusually high density of 21.2g/cm3, higher than almost any terrestrial material, and thus the visible gold surface is believed to be plated over another, possibly exotic, material. Only nondestructive testing has been permitted on SCP-1184 to date, and therefore the composition of its interior cannot be verified. While wearing SCP-1184, everything the wearer (henceforth known as the "speaker") says is accepted as the absolute truth by anyone able to hear and understand them (henceforth known as the "listeners"). Simple, easily accepted statements are taken at face value without apparent surprise, as with instructing D-class personnel that they will in fact receive a full pardon at the end of the month. Statements which are clearly at odds with reality, such as "I know this looks like an ordinary ballpoint pen, but it is in fact the nuclear aircraft carrier U.S.S. Enterprise", may create a significant amount of cognitive dissonance, depending upon the listener and situation. Listeners have been observed reacting to "impossible" statements in several ways: 1) Simply accepting the statement as fact without regard for its impossibility. Listeners told that a pen is an aircraft carrier and exhibiting this reaction would subsequently identify the pen as an aircraft carrier without appearing to find this fact remarkable. This is by far the most common reaction, and most test subjects never seem to notice anything unusual no matter how impossible their beliefs are. 2) Inventing (sometimes quite elaborate) confabulations to explain away the impossibility of their beliefs. Listeners exhibiting this reaction may invent fantastic stories involving shrink rays and disguise generators to explain how the ship came to resemble a pen. 3) Very rarely, listeners may conclude that the failure to "properly" perceive reality is their own fault. Listeners exhibiting this reaction may appear confused and claim that they are hallucinating or believe themselves to be suffering from other mental problems. Depending upon the nature of the implanted belief, this may cause extreme stress and anxiety over their inability to see the "truth" of the situation, and this may lead to actual psychological problems manifesting even in previously healthy individuals. There are no recorded cases of any subjects either realizing that their beliefs have in some way been manipulated or concluding that their implanted beliefs are untrue, no matter how seriously they disagree with reality or how plainly SCP-1184's effect is explained to them. Even SCP-1184 itself cannot override beliefs previously implanted by SCP-1184; the subject is unable to conclude that either belief is false, even if they directly conflict. A conflict between two SCP-1184 beliefs appears to have a higher risk of causing a psychotic break than a conflict between an SCP-1184 belief and reality, but the effect has not been quantified. Despite being absolutely convinced of the truth of statements heard under the influence of SCP-1184, listeners remain able to accept future changes of state. For instance, telling a listener that "this door is closed" convinces them that the door is currently closed, not that the door can never at any point in the future be open. If the door were in fact open, a listener might walk over to the open door (which they had been told was closed), pantomime opening the door, and then walk through it without incident, interacting normally with the door in the future. SCP-1184's effect only manifests when both the speaker and listeners understand the language being spoken, and listeners are hearing the sound directly from the speaker's lips. In particular, the following situations have never been observed to cause any anomalous effects to manifest: A speaker reading an unfamiliar foreign-language phrase to native speakers of the language. A "speaker" silently communicating with deaf listeners via mutually-understood sign language. A deaf listener lip-reading the speaker's words Listening to the speaker indirectly via any sort of electronic sound reproduction, whether in real time or recorded. Attempts to utilize SCP-1184 for its beneficial effects have been hampered by the fact that it also affects the speaker, who will become equally convinced of the truth of their statements. This has proven true even in the case of speakers who cannot hear themselves, as even completely deaf speakers (unlike deaf listeners) have proven to be subject to SCP-1184's effects. As no means of directly using SCP-1184 without being subject to its effects has yet been discovered, the following indirect test procedure forms the foundation of all SCP-1184 use: Test Procedure 1184-Sigma 1) Secure test subject(s) within SCP-1184 test chamber. 2) Researcher enters test chamber carrying, but not wearing, SCP-1184. 3) Researcher dons SCP-1184 and repeats the following passage verbatim: "It is vitally important that you do not voluntarily do or say anything unless I specifically tell you otherwise. In particular, you must not touch the ring I am now wearing unless I tell you otherwise." 4) Researcher removes SCP-1184 and places it on the table in the room, and then exits the test chamber. 5) Researcher triggers a prerecorded message in his voice instructing one of the subjects to don the ring. 6) Prerecorded message instructs the ring-wearer to repeat his words verbatim, and then continues very slowly and clearly with the message to be delivered to subjects. 7) Prerecorded message instructs ring-wearer to remove the ring, place it • • • • upon the table, and step away from it. 8) Researcher enters the room and retrieves SCP-1184. 9) Researcher leaves the room and uses the intercom system to inform subjects that they may speak and act normally again. When properly followed, this procedure results in all test subjects being implanted with the desired beliefs, without adversely affecting any SCP personnel. Strict adherence to the procedure is essential, as mistakes can and have led to loss of life or breaches of security. In particular: The word "voluntarily" was added to the test protocol after a subject apparently decided that "do not do or say anything" meant that she could not breathe. The requirement for a prerecorded speech was instituted after several incidents of flubbed lines by researchers. The consequences of these mistakes were generally relatively minor, but in the most extreme case [DATA EXPUNGED]. The initial speech to the test subjects must still be given "live" by the researcher for SCP-1184 to function, and thus has been kept short to minimize the chance of mistakes. The test subject wearing SCP-1184 remains a weak point in the process, as any misunderstanding or mistake in repeating the prerecorded speech's words can result in the wrong message being delivered. The SCP-1184 test chamber is equipped with an airtight door, separate ventilation system, and hydrogen cyanide gas canisters for this eventuality. During Incident-1184-7, Dr. ██████, then the head researcher on SCP-1184, deliberately deviated from his test script, instructing the D-class personnel to [DATA EXPUNGED] and using SCP-1184 to force everyone else he encountered to assist him with his plans. Over the course of his escape attempt, Dr. ██████ made 47 known statements while wearing SCP-1184, and at least ██ more which could not be deciphered from available security footage. Dr. ██████ was of course familiar with SCP-1184 test procedure and worded his statements carefully to avoid deluding himself, but shortly before exiting the facility it seems that a careless mistake caused him to convince himself that [DATA EXPUNGED], and he was easily captured and terminated. His final statement was inaudible in security footage, but the leading theory is that he stated something to the effect of [DATA EXPUNGED] upon realizing that the site had gone on full lockdown, thus rendering himself helpless. After careful psychological screening and review of security footage, many of the staff affected by Incident-1184-7 were eventually cleared to return to active duty. The affected D-class personnel were [REDACTED]. The current Level 5 approval and armed guard requirements were instituted in the wake of this incident. History: SCP-1184 was discovered in a mental facility in ████████████, ██ after reports of strange incidents came to the Foundation's attention. A Foundation team discovered SCP-1184 being worn by a patient known only as the King of ██████, being waited upon hand and foot by doctors, nurses, and other patients. The patient's true identity is unknown, as his name badge, room identification, and all medical records consistently referred to him as the King of ██████. All doctors, nurses, and patients in the facility suffered from a wide range of delusional beliefs concerning him, and the Foundation team charged with investigating the incident quickly fell under the "King"'s power. A backup team with soundproof headgear was able to neutralize the "King" and his sycophants, ultimately determining that the gold ring he wore was the source of his unusual power. Interrogating the "King" regarding SCP-1184 proved futile, as the • • • • • repeated careless use of SCP-1184 had left him deluded about his history, location, and identity. + Incident-1184-7 Followup Given that SCP-1184 was involved in at least one unauthorized use and may have been used on any of us before, during, or after that incident, there is no way for us to truly verify our facts. We believe that Dr. ██████ was undone by a careless misstatement, captured, and ultimately terminated. We believe that we are still in possession of the genuine SCP-1184, and not a worthless replica or merely an empty locker. We believe that we have brought in unaffected individuals from other Foundation sites in order to verify these facts. We believe that they have done so. We believe that we are researchers working for the Foundation. We believe that we show up to work every day and study various objects, including SCP-1184. We believe that we have homes, spouses, and children. But we have no means of determining, even in theory, if any of these facts are actually true or are merely delusions instilled by a user of SCP-1184. - Dr. ████ « SCP-1183 \| SCP-1184 \| SCP-1185 » ‡ Licensing / Citation Cite this page as: "SCP-1184" by dragonnyxx, from the SCP Wiki. Source: https://scpwiki.com/ scp-1184. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxevent-featuredinscriptionjewelrymemory-affectingmind-affectingsafescp page revision: 28, last edited: 21 Oct 2022 08:21 Edit Rate (+356) Tags Discuss (75) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1185 rating: +145+–x Item #: SCP-1185 Object Class: Euclid Special Containment Procedures: All currently known instances of SCP-1185 are to be maintained in storage at Site ██, with the exception of SCP-1185-3, which will remain installed in its original location and must be monitored at all times. Instances of SCP-1185 in storage are to be isolated from soil and other organic mediums at all times. Soil and organic media used in testing must be isolated from outside contact until the instance of SCP-1185 undergoing testing is removed from the area. Description: SCP-1185 is a collective designation for a set of gasoline pumps featuring identical manufacturer's marks and anomalous effects. Instances of SCP-1185 vary in age and design, in all cases appearing identical to other pumps installed in their facilities. The oldest known instance (resembling and installed alongside several Gilbarco Model 66 pumps) was installed in a rural Chilean town from 19██ until its discovery in 20██, while the newest (resembling a Dresser Wayne Century 2200 Series pump) was only one month old at time of discovery and removal by Foundation agents. All instances currently known possess identical manufacturer's markings on the base of the pump, though all other markings on the visible areas of the pump appear normal for the assumed model and manufacturer. These markings refer to a "Livewater Incorporated", an apparently fictitious corporation, the existence of which has yet to be substantiated. Employees and owners of fueling stations where instances of SCP-1185 have been located report no familiarity with any such corporation, and in all cases, the means of delivery and installation have been identical to common practice for non- anomalous pumps. When in close proximity to soil, instances of SCP-1185 extend fibrous tendrils from their bases towards the soil. These tendrils are metallic in composition, and are capable of penetrating several inches of concrete or asphalt should such stand between them and a mass of soil. Upon contact with suitably nutrient-rich soil, these tendrils branch out to form a pseudo-root-system of metallic fibers. The material composing the tendrils is an unknown metallic compound, which rapidly destabilizes and breaks down into various metal ions (primarily lead and copper) should the tendrils be disturbed. These fibers are hollow, allowing them to convey organic molecules to the pump, where an as-yet undetermined series of chemical reactions convert them into the component molecules of gasoline fuel. The exact composition of the fuel varies between instances, generally matching that of gasoline produced during the period of the pump's installation, and the process of conversion has no apparent mechanism; the substances extracted from soil appear to spontaneously break down and reassemble into the new molecular structures while passing through the pump. Disassembling and reassembling the pump has no effect on its anomalous properties, and installing any of an instance's components into other pumps of the same model will cause all components of that pump to take on the same anomalous properties. On initial installation, instances of SCP-1185 draw organic material from soil within a one-meter radius of the point of contact. Once soil resources have been drained to a degree that would render the supply inadequate, the pump’s tendrils extend further, resulting in its effects encompassing wider areas and causing increased depletion of soil resources. As operation of the pump continues, the increasingly widespread depletion of soil organic content begins to cause malnutrition in local flora and ground-based fauna. In cases where pump usage is especially prolonged or frequent, total ecosystem collapse can and will occur as the pump consumes and processes all available organic resources. Addendum 1185-001: On 4/13/██, a routine check on the fueling station where SCP-1185-1 was previously installed revealed similar anomalous properties in the new pump purchased as a replacement for the removed instance. The new pump was, according to the owner’s bank statements, purchased from the same corporation that had provided the other two, non-anomalous pumps in use. According to interview transcripts, a corporate representative met with the station owner and offered a heavy discount on the replacement pump to offset the loss of profits caused by the malfunction of the formerly installed pump (pump malfunction was indeed the cover-story used by the task force charged with removing and securing SCP-1185-1). On contacting and examining the records of the corporation in question, Foundation investigators found that a new pump was indeed shipped, but that no representative was ever sent, nor any discount offered, and that the funds received by the corporation were in accordance with the non-discounted price. The identity of the representative and source of the additional funds are currently under investigation. The pump, designated SCP-1185-3, is to remain installed at its current location and be kept under surveillance in hopes of establishing further contact with the producers or modifiers of the objects. « SCP-1184 \| SCP-1185 \| SCP-1186 » ‡ Licensing / Citation Cite this page as: "SCP-1185" by Daedalize, from the SCP Wiki. Source: https://scpwiki.com/ scp-1185. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxartifactbiologicaleuclidmechanicalscpsubterranean page revision: 15, last edited: 21 Oct 2022 07:58 Edit Rate (+145) Tags Discuss (19) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1186 rating: +69+–x A partially buried SCP-1186 instance located at Wenshu Monastery, Chengdu, China. Item #: SCP-1186 Object Class: Euclid Special Containment Procedures: SCP-1186 instances under Foundation custody are to be held in individual Insect Containment Units at Site-██. Each unit is to be constructed to resemble the human auditory system. The maximum number of SCP-1186 instances permitted in Foundation captivity is 140; excess instances are to be incinerated. 140 additional units are to be made available as reserve habitats for SCP-1186 instances. Civilians identified as hosts of SCP-1186 are to be taken under Foundation custody. SCP-1186 instances which are attached to hosts are to be extracted via invasive surgery. Affected civilians are to be placed under observation for a period up to two weeks. After which, interrogation and amnestic treatment are to be given. Description: SCP-1186 refers to a species classified under the family Cicadidae, with a mean body length of 2.5 mm. To date, all known SCP-1186 instances remain in their nymph stage and show no signs of metamorphosis typical of other members of the family Cicadidae. To the Foundation's knowledge, no SCP-1186 larva or imago are known to exist. In addition, dissection of SCP-1186 indicates the absence of sexual organs. Uniquely, SCP-1186 consumes endolymph from human cochlear ducts.1 As such, SCP-1186's physiology is optimised for the extraction and consumption of human endolymph, such as an elongated and retractable proboscis to puncture human skin and a digestive system specialised in breaking down substances with a high potassium concentration. However, SCP-1186 is known to survive without consumption of endolymph or any other forms of nourishment. Due to the loss of endolymph, hosts of SCP-1186 regularly experience deafness and balance disorder. After occupying the human ear for a period of one week, SCP-1186 will begin emitting vibrations directly to the skull via bone conduction. These vibrations are then interpreted as the chanting of various Mahayana Buddhist sutras2 narrated in respective hosts' arterial language. These chants are the only sounds constantly perceived by hosts, despite any auditory impairment on the host's part. These chants are inaudible in environments with sound levels of at least 50 dB, but hosts are known to suffer from afflictions such as headaches and nausea in such environments. In 2% of known cases, non-lethal damage to hosts' nervous tissues is present. Conversely, in environments with sound levels below 50 dB, the severity of the aforementioned afflictions tends to subside and audibility of SCP-1186's sounds increases. An illustration depicting 'Ascetic Sun', a figure held to be the previous incarnation of the Victorious Fighting Buddha, a deity revered by the 'Ascetics to Heaven's Pillar'. Other sacred sites believed to be associated with 'Ascetic Sun' have been contained by the Foundation as SCP-2711 and SCP-2178. SCP-1186 was discovered in Chengdu, Sichuan Province, China on ██/██/2007, where they were distributed by the new religious movement 'Ascetics to Heaven's Pillar'3 to its followers as an initiation rite. In cooperation with local law enforcement units, a crackdown on 'Ascetics to Heaven's Pillar' and its followers recovered approximately 500 SCP-1186 instances and halted distribution. 100 of such instances were kept for study at Site-██, while remaining instances were incinerated. Addendum 1186-1: Interviews with captured 'Ascetics to Heaven's Pillar' followers suggest that the Wenshu Monastery in Chengdu is a gathering point for said members. On ██/██/2007, Mobile Task Force Upsilon-4 ("Hot Iron Strike") was dispatched to raid temple grounds. Large populations (in excess of 5,000) of SCP-1186 instances were found during said raid. 40 SCP-1186 instances found at the Wenshu Monastery have been taken for study, while the remainder was terminated via incineration by MTF Y-4. Highest concentration of SCP-1186 instances is centred around a human cadaver seated in the Lotus Position and dressed in robes typical of Tang Dynasty bhikkhu.4 The cadaver has also been confiscated by the Foundation, tentatively classified as AI- █████ and pending further research. A profile for AI-█████ is as follows: Item Description: A preserved human cadaver dressed in Tang Dynasty-era bhikkhu robes. Radiocarbon dating estimates the cadaver's year of death at circa 620 – 680 CE. Despite its age, no signs of decomposition are found; mechanism of preservation is unknown. Date of Recovery: ██/██/2007 Location of Recovery: Chengdu, Sichuan Province, China Current Status: Kept at Anomalous Items Wing in Reliquary Site-███. Footnotes 1. Endolymph from several species of mammals (e.g. cattle) are acceptable substitutes in place of human endolymph. 2. Said chants include the Amitabha Sutra, Heart Sutra, Lotus Sutra among others; see Document 1186- for a complete list of sutras. 3. (tiān zhú xíng zhě); a Mahayana Buddhist-inspired religious movement, known for its veneration of figures such as Victorious Fighting Buddha ( ; dòu zhàn shèng fó), Cleanser of the Altars ( ; jìng tán sh zhě), Gold-Bodied Arhat ( ; jīn shēn luó hàn), and Dragon Horse of the Eight Heavenly Sections ( ; bā bù tiān lóng m ). 4. Designation of a fully ordained monk in Buddhism. « SCP-1185 \| SCP-1186 \| SCP-1187 » _ccacousticanimalauditorybiologicaleuclidinsectknowledgereligiousscp page revision: 29, last edited: 26 Sep 2022 20:48 Edit Rate (+69) Tags Discuss (19) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1187 rating: +120+–x Item #: SCP-1187 Object Class: Safe Special Containment Procedures: SCP-1187 is to be stored in a remote, above- ground enclosure 5km from Site 19 with a staff of 2 armed guards and 1 Level 1 researcher. SCP-1187 should remain inverted upon its transportation trailer at all times when not being tested. The subject's ignition key, designated SCP-1187-1, is to be stored in the office of the Level 3 director at Site 19 overseeing SCP-1187, and is available upon written request. Testing must be conducted no less than 10km from any Foundation facility or population center. SCP-1187 is to be removed from its trailer and operated by a Class D subject in the center of a 500m cleared circle. All security and research personnel should remain at the edge of the perimeter, directing and observing the test remotely. Description: SCP-1187 is a blue 2006 Kazuma 150cc All Terrain Vehicle. It was sold and delivered to ██████ ████ of ████████, South Carolina via an anonymous online merchant site. The seller has yet to be located. The owner's initial test ride resulted in an anomalous incident which was suppressed in public media as a powerful but isolated earthquake. When the accelerator is engaged SCP-1187 remains stationary while the surface beneath its wheels shifts horizontally towards the rear of the vehicle at an increasing rate of speed. SCP-1187 is capable of dragging a 3m wide by 15cm deep strip of terrain at speeds of up to 40kph. This effect extends to approximately 250m in front of the vehicle and 50m behind. Continued operation will shear an increasing amount of material from below the top layer, eventually excavating a furrow and depositing it to the rear of SCP-1187. Manipulating the steering column will rotate SCP-1187 and shift the area of influence. Applying the brakes will slow and eventually cease the effect. Operating SCP-1187 in the vicinity of buildings or other above ground structures and objects is exceedingly dangerous, as mass above the driving plane is not arrested by braking. « SCP-1186 \| SCP-1187 \| SCP-1188 » ‡ Licensing / Citation Cite this page as: "SCP-1187" by Ink Asylum, from the SCP Wiki. Source: https://scpwiki.com/ scp-1187. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxmechanicalsafescptelekineticvehicle page revision: 12, last edited: 21 Oct 2022 08:09 Edit Rate (+120) Tags Discuss (27) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1188 rating: +240+–x Item #: SCP-1188 Object Class: Safe Special Containment Procedures: SCP-1188 is stored in a secure locker in Site-██ with its batteries removed. SCP-1188's batteries may not be inserted within 100m of Site-██'s outer walls, and all testing is to be performed at least this distance from any personnel or structures not involved in testing, and under no circumstances should SCP-1188 be pointed at a living organism unless this is specifically part of a test. SCP-1188's batteries are to be promptly removed at the conclusion of testing. Description: SCP-1188 appears to be a standard black ███ ████-brand flashlight, manufactured by ███ ██████████, Inc. circa 1983. Its construction and appearance are unremarkable, and it displays an amount of wear appropriate for its age. SCP-1188 accepts ordinary D batteries, activating via a toggle button. When active, instead of producing a beam of light, SCP-1188 temporarily displaces matter in a truncated cone originating from the bulb end of SCP-1188. The far end of the cone is 21.2m from the end of SCP-1188 and 2.2m wide. Matter within the cone appears to have been completely eradicated, leaving a cone-shaped "hole" through whatever SCP-1188 is being pointed at. SCP-1188 can be freely redirected, causing the "hole" to shift. Matter which is no longer being displaced reappears, apparently unharmed, and switching SCP-1188 off causes all displaced matter to reappear. SCP-1188's bulb remains unlit while operating, though its anomalous effects disappear if the bulb is removed. SCP-1188's bulb functions normally when used in other flashlights. Test 1188-1 - Date ██/██/████ Subject: Tree outside Site-██ Results: Shining SCP-1188 on tree appears to "cut" a section out of the tree's trunk, completely bisecting it. The top of the tree does not collapse, despite no apparent means of support. The internal structure of the tree is clearly visible. SCP-1188's "beam" is slowly moved up and down the trunk, causing the hole to move up and down but without apparent harm to the tree itself. Test 1188-2 - Date ██/██/████ Subject: Ground outside Site-██ Results: SCP-1188 "carves" a deep hole in the ground, allowing researchers to see into the ground. As SCP-1188 does not shed light like a normal flashlight, it is difficult to see into the hole unless it is aligned with the sun. With the hole at an angle, Researcher ████████ walks on the undisturbed ground above the displaced hole with no ill effect. Test 1188-3 - Date ██/██/████ Subject: Video camera Results: Video camera is set to record and then displaced using SCP-1188. Upon return, video shows a view of a curved wall, believed to be the inside of a silo. Test 1188-4 - Date ██/██/████ Subject: D-16621 Results: D-16621 is restrained and his hand is "illuminated" by SCP-1188, developing a circular hole through it and exposing the internal structure of his hand at the edges of the hole. Upon witnessing this, D-16621 screams, but is found to be uninjured and the hole in his hand is restored when SCP-1188 is switched back off. SCP-1188 is moved to a greater distance in order to create a larger area of displacement and various areas of D-16621 are displaced beginning with his extremities. No ill effects are apparent, although D-16621 finds the process very distressing. Displacing D-16621's head for several seconds causes him to vomit upon his return. D-16621 attributes this to vertigo, as his head was approximately fifteen feet above the ground and facing straight down when displaced, and the sudden shift was disorienting. D-16621 reports seeing the same or similar building as the video camera and identifies it as an empty grain silo. Test 1188-5 - Date ██/██/████ Subject: GPS tracking beacon Results: Tracking beacon is able to acquire a good signal and reports its location as a rural area outside ████████████, England. Foundation agents are deployed to secure the area. Team ████ Mission Report: Grain silo found at indicated location. Area surrounding silo is a farm in extreme disrepair, no inhabitants. When activated, the entire cone of matter displaced by SCP-1188 is visible in the air in the exact center of this silo. If you shine SCP-1188 at the ground, you get a fifty or sixty foot cone of dirt hanging in the air. If you move SCP-1188 around, the cone hanging in the air doesn't move but you can see its contents changing. It's one of the weirdest things I've ever seen. Agent ████████ volunteered to have the thing shined on him. Because the small end of the cone is at the bottom and he was looking at it when we switched it on, his upper body was hanging in midair staring down at the ground. He could see his own torso, cut open and showing his guts and everything, but then he fell down and his head came back. He threw up all over the place. Can't say I blame the guy. - Agent ██████████ Addendum 1 D-16621 became extremely ill 48 hours after exposure, with severe nausea, vomiting, and anemia, dying two days later due to multiple organ failure. Agent ████████'s symptoms were similar but much more acute, with rapidly worsening neurological problems resulting in death six hours after exposure. SCP-1188 is no longer to be used on living organisms. Addendum 2 Careful study has revealed that displacement via SCP-1188 causes microscopic damage to material along the edge of the displaced region. The damage is extremely small scale, disrupting a small percentage of the molecules along the edge. For bulk materials the damage is inconsequential — displacing a volume of water breaks an infinitesimal fraction of it into its component hydrogen and oxygen, which has a negligible effect. For living organisms, damaging even a small percentage of the DNA, enzymes, cell walls, and so forth can cause catastrophic damage. The damage is not actually caused by ionizing radiation, but the type of damage is very similar and the resulting symptoms therefore strongly resemble acute radiation syndrome. As D-16621's head was displaced all at once, but Agent ████████'s head actually slid through the edge of the displaced region, Agent ████████ developed severe neurological symptoms while D-16621 did not. Displacing an entire body at once, with no part of the body crossing the edge of the displaced region, should avoid this sort of damage in the future. - Dr. ███████ « SCP-1187 \| SCP-1188 \| SCP-1189 » ‡ Licensing / Citation Cite this page as: "SCP-1188" by dragonnyxx, from the SCP Wiki. Source: https://scpwiki.com/ scp-1188. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxelectricalsafescpspatialtool page revision: 12, last edited: 03 Jan 2023 15:30 Edit Rate (+240) Tags Discuss (33) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1189 rating: +56+–x Item #: SCP-1189 Object Class: Euclid Special Containment Procedures: SCP-1189 is to be kept in a soundproofed steel box measuring one (1) meter by one (1) meter by one (1) meter. Testing of SCP-1189 should be performed in a soundproofed room, with at least two (2) armed guards stationed outside at all times. Personnel in contact with SCP-1189, as well as security personnel present during testing, must be equipped with earplugs or other sound-dampening devices with a Sound Transmission Class of forty (40) or above. [NOTE: NO LONGER IN EFFECT. See Addendum 013-01] Description: SCP-1189 is a sound, measuring an average of forty decibels, accompanied by a pale green glow. SCP-1189 has no discernible physical source, though it appears to originate from the small area at the apparent center of the glow. Due to the effects of hearing SCP-1189, knowledge of the sound produced is limited to sound level meter readings. The readings appear to resemble those generated by speech, though no correlation to any known language has been found, and no pattern has been observed. [NOTE: See Addendum 013-01] SCP-1189 appears to be a self-propagating sound. Subjects that hear SCP-1189 become entirely unresponsive for periods of time ranging from fifteen minutes to just over two hours. Upon emerging from this state, affected subjects appear frantic and immediately attempt to cause others to hear SCP-1189. If resisted, affected subjects become violent. During [DATA EXPUNGED], Agent ████ was accidentally exposed to SCP-1189. Agent shot and killed his partner, Agent ██████, as well as three security personnel and a Level 1 engineer performing maintenance on SCP-1189's containment. Agent was killed by security personnel while attempting to force entry into the surveillance room for Floor 27. Agent was holding a field tape recorder which contained a recording of SCP-1189. SCP-1189 was discovered in an abandoned recording studio. The control room contained several pieces of unidentified electronic equipment, and appeared to have been thrown into considerable disarray. The door to the studio was barred from the outside. The studio itself contained SCP-1189 and a single badly decayed corpse. Attempts to identify the corpse have been unsuccessful. Though SCP-1189 had been previously contained on-site, an attempt was made to transport it by constructing a soundproofed steel box around the estimated center of SCP-1189 and transporting the box. The attempt was successful, with no trace of SCP-1189 remaining in the original location, and all readings within the box remaining identical to those taken before transport. All contents of the recording studio were destroyed. Experiment Log: 013-001 Name: Dr. ██████ Date: █/█/███ The box containing SCP-1189 was placed in a soundproofed room, and all air was evacuated from both the room and the box. Subject D-013-01 entered the room wearing a Type-5 containment suit and opened the box. SCP-1189 was immediately heard through the suit's headset, affecting the personnel in the control room overseeing the test, including Dr. ██████. Dr. ██████ opened the airlock and attempted to record the sound before being neutralized by security. All personnel within earshot of SCP-1189 were affected, with symptoms decreasing with distance from SCP-1189. Upon psychological evaluation of personnel within extreme range of SCP-1189, they reported growing increasingly agitated as they attempted to remember what they had heard, playing random notes and experimenting with audio software in an attempt to recreate it. Such personnel were terminated. Addendum: 013-01 On █/█/███ at 05:23, analytical software monitoring SCP-1189 detected a pattern. At 06:04 a recording of SCP-1189 was broadcast over emergency loudspeakers to all of Floor 27. Emergency security personnel were alerted, but were also affected upon reaching the floor. The broadcast continued until standard and emergency power to the entire floor had been cut, resulting in a loss of containment for three other SCPs, including SCP-███. Emergency containment crews disconnected all loudspeakers and restored power to the floor. All readings from within SCP-1189's containment had ceased, and SCP-1189's absence was confirmed using Class D personnel. Upon further investigation, it appears that the computer running the analytical program monitoring SCP-1189 for patterns had generated a piece of malicious code that was implemented on the floor's computer network, allowing the recording of SCP-1189 to be uploaded to the emergency broadcast system. Investigation into SCP-1189's whereabouts is ongoing. Recommend immediate reclassification of SCP-1189 to Euclid class. « SCP-1188 \| SCP-1189 \| SCP-1190 » ‡ Licensing / Citation Cite this page as: "SCP-1189" by Beich, from the SCP Wiki. Source: https://scpwiki.com/ scp-1189. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxacousticauditorycognitohazardcompulsioneuclidmind-affectingscp page revision: 23, last edited: 20 Oct 2022 21:37 Edit Rate (+56) Tags Discuss (47) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-119 rating: +443+–x A similar model. Item #: SCP-119 Object Class: Euclid Special Containment Procedures: SCP-119 is to remain open and unplugged at all times except during testing. The door to the room in which SCP-119 resides is to be locked for all periods except during experimentation, with the entry codes given only to authorized research and security personnel. An industrial-grade disinfectant will be available nearby at all times, and the inside of SCP-119 is to be heavily disinfected before any testing. The contents of SCP-119 are to be monitored through the viewing window on SCP-119 at all times during testing, and will be stopped immediately should the contents become hostile or otherwise damaging to SCP-119. Description: SCP-119 is a Panasonic [REDACTED] Microwave Oven. It was initially discovered by an agent, who had bought it from a liquidation sale of the assets from ████ Valley Vineyards. It is believed that ████ Valley Vineyards was using the anomalous properties of SCP-119 to rapidly age its products and create expensive vintages. Records show ████ Valley Vineyards making under-the-table sales of vintages dated as far back as 19██, many years before the company's inception in 2005. These sales are what led to the lawsuits accusing the company of falsifying product information and other forms of fraud, which eventually caused ████ Valley Vineyards to declare bankruptcy. SCP-119 appears to be a standard model of microwave in all respects except that the magnetron unit does not produce microwave radiation. Instead, the magnetron emits a previously unknown type of radiation that accelerates time. The amount of time accelerated is based on the time input given at the start, and the power level setting. The time input allows for three digits, and there are five power level settings. On power level 1, the number of seconds input equals the number of seconds experienced within the microwave. Therefore, an input of 30 seconds would cause the microwave to run for 30 seconds, at the end of which the object will have aged 30 seconds. Each subsequent power level past 1 causes an exponential increase of the acceleration of time. At power level 2 with an input of 30 seconds, the microwave will run for 30 seconds and the contents will have aged 900 seconds (15 minutes) or 3030 seconds. At power level 5, with an input of 999 seconds, the microwave will run for 999 seconds, and the contents will have aged 995,009,990,004,999 seconds (31,529,964 years). Experimentation with the other buttons on the microwave have not resulted in any anomalous properties, although they do still function as would be expected from a normal microwave. The "minute +" button, for example, adds 60 seconds, and the "defrost" function prompts the user to open the door and flip the contents periodically. Pressing the "minute +" button during operation, however, does not recalculate the adjusted time acceleration, merely causing the contents to age at the pre-calculated rate for another 60 seconds. (eg: Power Level 2 for 30 seconds would age for 900 seconds (15 minutes), input of "minute +" would result in the microwave running for 90 seconds and aging the contents 2700 seconds (45 minutes), or 3(3030), instead of aging the contents for 8100 seconds (135 minutes), or 90*90). SCP-119 can be dismantled, and replacement parts can be substituted for every component except the magnetron. When placing the magnetron in any other microwave, including duplicates of the same model, the magnetron continues to exhibit time acceleration. However, replicating the effects of anything above power level 2 have failed in every model except the original microwave in which the magnetron was found. Although SCP-119, like all standard microwave models, will normally only function when the door is closed, during deconstruction it was determined that disabling the closing mechanism allows the device to work while open. Subsequent testing determined that the radiation emitted from SCP-119 has a fallout pattern very similar to the microwave radiation it replaced. However, further experiments operating SCP-119 while open now require the approval of a Clearance Level 4 personnel. Addendum: After subsequent testing, it has been determined that the accelerated time experienced within SCP-119 is not accelerated from the perspective of those being affected, instead causing the occupants to perceive that they are simply staying inside of the microwave for the adjusted duration. Should living creatures be exposed to SCP-119 for extended durations, they could quite quickly die of starvation, as they will require as much sleep and food as they would outside of SCP-119. Therefore, further experimentation with living beings now requires the approval of a Clearance Level 4 personnel. Furthermore, due to the possibility of micro-organisms undergoing accelerated evolution within SCP-119, industrial-grade disinfectant has now been added to the containment procedure for SCP-119. Test Log for SCP-119 « SCP-118 \| SCP-119 \| SCP-120 » ‡ Licensing / Citation Cite this page as: "SCP-119" by elrosth, from the SCP Wiki. Source: https://scpwiki.com/ scp-119. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. Filename: scp119-new.jpg Name: White Panasonic Microwave.jpg Author: librarianidol License: CC BY 2.0 Source Link: Wikimedia Commons _licenseboxapplianceelectricaleuclidradioactivescptemporal page revision: 17, last edited: 01 Dec 2024 20:12 Edit Rate (+443) Tags Discuss (52) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1190 rating: +261+–x Item #: SCP-1190 Object Class: Safe Special Containment Procedures: SCP-1190 is to be contained in a secured, temperature-controlled observation room. The observation room must provide accommodations for long term living, to include a cot for sleeping, a restroom, and a food preparation area. Video surveillance equipment is to be installed outside the observation windows to record the device’s output as well as any input provided by SCP-1190-1. All recordings from the surveillance equipment are to be permanently archived for study. A nurse or nurse assistant must be available to care for SCP-1190-1. Nurse duties include delivery of food, bathing, feeding, application of medicine, administration of intravenous feeding systems, and other tasks necessary for the care of a potentially severely disabled person. Personnel are not to interact directly with SCP-1190 except for D-class personnel cleared to be used as test subjects. Any D-class subjects to be used for testing SCP-1190 are to be cleared with site administration for a stay of execution during the course of the experiment. Procedure update following experiment 1190-1: The floor of the observation room must have a central drain for eliminating waste. Procedure update following experiment 1190-2: SCP-1190 is to be powered at all times, with backup batteries and a diesel generator in case of power failure. Description: SCP-1190 is a 1973 Hewlett Packard 3000 computer system. Installed on the device is a program which performs a physics simulation, beginning with the known origins of the universe. Observation of the simulation suggests that it is capable of simulating physical phenomena beyond our current understanding. While running the program, SCP-1190 exhibits inexplicably powerful processing capability, an anomaly which does not persist while the device performs other tasks. Attempts to decompile the program or to move it to a different device have failed. The program appears to be corrupt to all observations and actions beyond running it on SCP-1190. Aside from its anomalous performance characteristics and the inexplicably accurate logic used by the simulation, the only other notable physical characteristic of SCP-1190 is that it is unusually well maintained for its age. Otherwise, it appears to be a normal example of a computer of its make and model. When the program is executed on SCP-1190, the screen displays: Press Enter to Begin… Any individual who activates the program stored on SCP-1190 will become fascinated with the simulation. The individual will want to intervene in the development of the virtual universe to cause it to proceed according to the individual's personal ideals. The individual is designated SCP-1190-1. Over time, SCP-1190-1 will become more obsessed with the simulation, increasingly neglecting personal needs in favor of managing the virtual universe. Documentation of known commands can be obtained with consent from at least one personnel having clearance level 2/1190 or greater; however, the documentation is believed to be far from complete. Each new subject intuits new commands over time, and while video of the subject's input and the observable results on the simulation have been archived, the exact effects of many commands haven't yet become clear. History: SCP-1190 came to the attention of The Foundation via an asset embedded in the security department of █████████ Laboratories. On ██/██/████, a janitor at █████████ Laboratories reported to security that an unpleasant smell was coming from a disused office. In the office, the responding security officer found a researcher who was thought to have been missing for several weeks (D████ C████, hereby designated SCP-1190-1-A) operating SCP-1190 and surrounded by days of her own refuse and waste. SCP-1190-1-A had at some point brought several days worth of food and water to the office, but only a small amount of water remained. SCP-1190-1-A displayed symptoms of stage 3 starvation: flaking skin, thinning hair, and insufficient strength to sit up properly. However, SCP-1190-1-A was still operating SCP-1190 while muttering inaudibly. The security officer attempted to administer aid, but SCP-1190-1-A was uncooperative until the officer disconnected the power to SCP-1190. SCP-1190-1-A became violent and attempted to attack the officer, but because of the aforementioned symptoms was easily subdued. SCP-1190-1-A expired from systemic infection secondary to starvation while being rushed to the hospital. + Transcript of video taken by security officer Officer: “D████? Is that you? Ugh, it stinks in here—are you okay?” SCP-1190-1-A: [INAUDIBLE] Officer: “Holy [EXPLETIVE REDACTED]! D████! Your hair—your skin! What happened to you? SecOps, we need medical on floor █, office ███ immediately! Ugh, what the hell are you sitting in? Stay with me, girl!” SCP-1190-1-A: [INAUDIBLE] Officer attempts to remove SCP-1190-1-A from the terminal, but she resists. Officer: “Hey—what’s going on here? You need help! Let me help you!” Officer waves a hand in front of SCP-1190-1-A and gets no response. The officer then unplugs SCP-1190 from the wall. Officer: “You’ve got to focus! Stay with me!” SCP-1190-1-A: “You… you killed them… m-murderer! You killed them all!” SCP-1190-1-A attempts to lunge at the officer, but lacks the strength to stay upright and collapses. SCP-1190-1-A claws at the officer’s legs. Officer: “W-what are you doing? You’ve got to hold still! Ouch! Hey, I’m here to help you!” The officer restrains SCP-1190-1-A with a pair of handcuffs. Officer: “SecOps, you’d better get a stretcher up here—something with restraints, I just found D████ and she is delirious and in bad shape.” SCP-1190-1-A: “Billions… you killed billions. They needed me, I gave them paradise, and you killed them. Monster!” SCP-1190 was taken into containment by The Foundation on ██/██/████. Experiment Logs: + Excerpts from Experiment Log 1190-1 Subject: D-class personnel D-11593 is a 53 year old Caucasian male. Subject Background: A former network administrator, D-11593 is a sociopath convicted on 6 counts of torture and murder in the first degree. D-11593 (hereafter referred to as SCP-1190-1-B) was selected for this experiment due to high scores on computer aptitude tests. Day 1: SCP-1190-1-B was locked in the observation room for SCP-1190. Subject was instructed to begin the simulation, and to keep a diary during the experiment. Subject was given no further instructions. Day 2: SCP-1190-1-B spent 2 hours tending to the simulation. Excerpt from subject diary “They’re making me run some kind of simulation, it seems. So far all I can see are a bunch of white pixels moving away from each other. I can make them move a little faster or a little slower, but that’s about it.” Day 7: SCP-1190-1-B spent 8 hours tending to the simulation. Excerpt from subject diary “The stars, they have planets! I figured out how to start a chain reaction in a star that makes it supernova and take out a bunch of planets with it. Maybe if I fast forward enough, I can find one with some playthings.” Day 12: SCP-1190-1-B spent 14 hours tending to the simulation. The rest of the day was spent sleeping and eating with no recreation. Excerpt from subject diary “I found another planet with some life starting. I shouldn’t have broken the last planet with life; it took me too long to find another one. This time I think I’ll be more subtle and see how much a life form can take before it just can't live anymore.” Day 20: SCP-1190-1-B spent 18 hours tending to the simulation. Subject ate at the terminal, leaving only to sleep and use the restroom. Excerpt from subject diary “I figured out how to keep the creatures I created alive, even when most of them just want to die. The young ones cry and shake from the pain, but as they get older, they seem to get used to it. I have to figure out a way to change up the pain as they get older, so it will never end.” Day 42: SCP-1190-1-B spent 20 hours tending to the simulation. Subject ate at the terminal, and only left the simulation to use the restroom. SCP-1190-1-B fell asleep for 4 hours at the desk; upon waking up, subject displayed some anxiety about having drifted off. When instructed to write in the journal, SCP-1190-1-B became agitated and had to be threatened with an electric prod before complying. Excerpt from subject diary “The last of the creatures from planet 7 died out today while I was asleep. I should have been there so it wouldn't have been so quick. Now they're making me spend more time away from the universe to write this entry; who knows what else I'll miss? I suppose I was getting bored anyway, they can only scream so much. I think this time, I'll make the life on planets 12 and 13 evolve so they are perfect for killing each other, then open up a wormhole between the planets and see who wins.” Day 84: SCP-1190-1-B spent 24 hours tending to the simulation. Subject no longer eats independently, and has been placed on intravenous feeding. The nurse has to give the subject sponge baths, and a drain has been installed in the floor so waste can be flushed. In addition, the nurse has been instructed to regularly manipulate the subject's extremities to mitigate complications from long-term immobility. When instructed to write in the journal, subject remains unresponsive, even if shocked with an electric prod. Transcript of surveillance video SCP-1190-1-B: “No, it can't be over this soon! I know, I'll bring them back, let them fight it out again…” Day 105: SCP-1190-1-B suffered from a pulmonary embolism resulting from a deep-vein thrombosis. Subject began to have trouble breathing and started coughing. The research assistant on duty called for the nurse, who was off duty and took nearly 30 minutes to respond. By the time the nurse arrived, the subject's symptoms had transitioned to bloody coughing and collapse. Before losing consciousness, SCP-1190-1-B rendered the simulation unusable by bringing about the destruction of the virtual universe. SCP-1190-1-B was transferred to medical, where an anticoagulant was administered, but SCP-1190-1-B expired from sudden cardiac death. Transcript of surveillance video SCP-1190-1-B begins exhibiting trouble breathing, including wheezing and coughing. Research Assistant Dr. █████ : “Hey, what's going on with our guy? Get the nurse to check him out.” Approximately 30 minutes elapses before SCP-1190-1-B begins coughing up blood. SCP-1190-1-B: “What… what's happening…” SCP-1190-1-B's posture becomes limp during onset of collapse; the nurse arrives and is cleared to enter the observation room. SCP-1190-1-B: “I can't… leave them… alone. If I go… they're coming with me.” Nurse ███████ : “We've got tachypnea, hemoptysis and cyanosis. We need to get him to medical immediately!” SCP-1190-1-B loses consciousness. Nurse ███████ was reprimanded for responding to a priority 3 page in excess of 10 minutes. Video of this incident is under consideration for staff training purposes. + Excerpts from Experiment Log 1190-2 Subject: D-class personnel D-14899 is a 37 year old Hispanic female. Subject Background: A former professional artist, D-14899 was convicted on 2 counts of murder after one of her art pieces was vandalized. D-14899 (hereafter referred to as SCP-1190-1-C) was selected for this experiment due to an artistic background. Day 1: SCP-1190-1-C was locked in the observation room for SCP-1190. Subject was instructed to begin the simulation, and to keep a diary during the experiment. SCP-1190-1-C was given no further instructions. Day 2: SCP-1190-1-C spent 1 hour tending to the simulation. Excerpt from subject diary “This place is like so many other prisons, and yet unlike them. I heard sounds … or maybe I didn’t… in the other areas. Had strange feelings. Ideas came into my mind, inspirations… I want to paint them, but I can't. All I have is this diary, and some computer, showing dots.” Day 4: SCP-1190-1-C spent 2 hours tending to the simulation, and 6 hours sketching in the diary. Subject's request for assorted art supplies denied. Excerpt from subject diary “I tried. I tried to get the ideas out, but I can only do so much with a pencil. The only other thing in here to look at is that computer, and all I can do is move around in space. If only there were some colors to look at.” Day 9: SCP-1190-1-C spent 12 hours tending to the simulation. The rest of the day was spent writing extensive diary entries, eating and sleeping. Excerpt from subject diary “This is amazing! It's the world's biggest, most perfect canvas! But it's more than that. I can shape galaxies into flowers, and those into gardens. I can paint the horizon of a beautiful purple moon with stars that change colors as the planet rotates. It's sculpting, and painting, and music and dance, all at once!” Day 21: SCP-1190-1-C spent 20 hours tending to the simulation. Subject eats meals at the terminal, and leaves only to use the restroom, to sleep for 2 hours, and to make entries in the diary. Excerpt from subject diary “I created the perfect woman. Tall, beautiful, unusual and yet familiar. She seems motherly and yet distant. Her children are unformed pieces of clay with endless possibility. She recognizes their potential, and is proud, but still cries when I transform them. It is beautiful… some people can sculpt what they feel, but only I can literally sculpt using raw emotion.” Day 30: SCP-1190-1-C spent 23 hours tending to the simulation. Subject eats meals at the terminal, and leaves only to use the restroom and to make entries in the diary. Excerpt from subject diary “Art can mean so much more when you're not bound by rules. I can make a line of colors that didn't exist until I invented them that goes from one end of the universe to the other, and it will never move or fall down. I reshaped the structure of carbon to make shapes I never could have thought of in my wildest dreams!” Day 31: A breach of containment by SCP-███ caused an extended power interruption which powered down SCP-1190. After a momentary delay, SCP-1190-1-C became violent, attempting to destroy objects in the room other than SCP-1190. Security had to enter the observation room to contain the outburst. SCP-1190-1-C is currently restrained in medical. Class A amnestics were administered, but the subject continues to exhibit symptoms similar to sustained withdrawal, including depression, anxiety, fatigue and nausea. Subject indicates that she undergoes persistent cravings for an unidentifiable "fix". + Excerpts from Experiment Log 1190-3 Subject: D-class personnel D-17019 is a 67 year old Caucasian male with moderate obsessive-compulsive disorder manifesting in a compulsion to place objects into certain patterns. Subject Background: D-17019's was convicted on 1 count of arson resulting in the deaths of 9. D-17019 (hereafter referred to as SCP-1190-1-D) was selected for this experiment due to a unique concept of organization. Day 1: SCP-1190-1-D was locked in the observation room for SCP-1190. Subject was instructed to begin the simulation, and to keep a diary during the experiment. SCP-1190-1-D was given no further instructions. Day 2: SCP-1190-1-D spent 1 hour tending to the simulation. Excerpt from Subject diary: "Nothing is where it should be the cot is on the north wall with the head facing east. And then there's this computer! The dots are all wrong in every way. I want to get in there and fix them so badly.” Day 3: SCP-1190-1-D has suffered from a sudden embolic stroke. Because the stroke occurred while the nurse was on duty, the subject was able to be transferred immediately to medical. Reports indicate that the subject has been stabilized and that partial recovery is likely; however some damage to the ventral striatum is likely to be permanent, which may affect the subject's long-term behavior. Day 8: SCP-1190-1-D released from medical and subjected to a full psych evaluation. Reports indicate that the subject no longer feels compulsion to reorganize objects. Day 9: SCP-1190-1-D placed back into the observation room for SCP-1190. Subject spent no time tending to the simulation. Excerpt from Subject diary: “Things which used to seem so significant don't anymore. Nothing really motivates me like it used to.” Day 10: SCP-1190-1-D spent no time tending to the simulation. Day 17: SCP-1190-1-D spent no time tending to the simulation. Subject appears to be immune to the compulsion to interact with SCP-1190. Subject's stay of execution will be revoked, and subject will be remanded to general Foundation custody. Experiment log, ██/██/████ “With SCP-1190-1-D's brain damaged, it appears that SCP-1190 no longer is able to exert a compulsive effect on the subject. While some might call this experiment a failure, it presents a heretofore unavailable opportunity to let the simulation run its course without intervention. The results of this "pure" simulation could be very interesting.” « SCP-1189 \| SCP-1190 \| SCP-1191 » ‡ Licensing / Citation Cite this page as: "SCP-1190" by Foxen, from the SCP Wiki. Source: https://scpwiki.com/ scp-1190. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxcompulsioncomputersafescp page revision: 27, last edited: 21 Oct 2022 08:20 Edit Rate (+261) Tags Discuss (55) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1191 rating: +101+–x Item #: SCP-1191 Object Class: Safe Special Containment Procedures: SCP-1191 is to be stored in an opaque Type IV Safe-class containment locker at Sector-28. Neither it nor its locker is to be handled in any way except as necessary for testing. If the object must be moved, the entire locker is to be relocated by a team of Class-D personnel, all of whom must be given every reason to believe that the locker is empty. The locker is to be dehumidified and protected from insect and fungal infestation, and the object should be given regular visual-only checks for deterioration. Description: SCP-1191 is a rotten willow tree branch approximately 97 cm long by 1.5 cm in diameter, with a prominent kink 31 cm from the base. Any intentional manipulation of SCP-1191 results in the activation of its anomalous properties, which are not fully categorized at this time. "Manipulation" includes any physical contact, made either directly or indirectly via handheld or remotely-operated tools, with the intent of examining, moving, damaging, or otherwise directly affecting SCP-1191. Contact made at one remove — i.e. by ordering another person to handle SCP-1191 — affects the person in direct contact, but not the person who gave the order. Contact with a container holding SCP-1191 counts as manipulation if and only if the contactor is aware of SCP-1191's presence inside the container. All contact with SCP-1191 has been carried out by D-class personnel with histories of violent crime. Persons handling the object report immediate panic and disorientation. They begin, quickly and without external provocation, to protest their innocence. Further investigation reveals them to bear memories of an alternate timeline in which they did not commit one particular act of violence — in most cases, the act which led to their eventual relegation to Class D. Affected personnel retain these memories indefinitely, although they gradually re-acquire memories of our timeline over a period of forty hours after contact. During these first forty hours post-exposure, subjects frequently claim SCP-1191 retroactively inserted a violent episode into their personal history. In support of their claims, these subjects have demonstrated implanted knowledge beyond their clearance, both of technical details and inter-personal information. Use of D-class personnel in certain contact events appears contrary to Foundation procedure. It is presently unclear whether SCP-1191 is causing spurious knowledge generation or actually altering timelines. A test capable of distinguishing between these possibilities has not yet been designed. Addendum: Recovery Report Agent █████ was dispatched to ████, Canada to investigate unusually high density of violent crime, accompanied by former convict D█████. The pair discovered an abandoned vehicle in a wooded lot located at 4█.████° N, 1██.████° W. While investigating the vehicle, D█████ picked up SCP-1191. Agent █████ reports immediate distress, followed by abrupt and unprompted denial of a previous crime, in support of which D█████ demonstrated detailed knowledge of Foundation retrieval agent procedure. Agent █████ returned without permitting D█████ to release SCP-1191 at any point, employing coercion where applicable. No further items resembling SCP-1191 have been recovered from the recovery site. D█████ was later administered a Class-R amnestic and designated personnel D-1191-1. Addendum: Excerpts from Experiment Log 1191 Test 3 Date: ██-██-████ Subject: Personnel D-1191-12 Procedure: D-1191-12 was instructed to remove a one-centimeter transverse section of SCP-1191 using a circular saw. Results: Upon picking up SCP-1191 to move it onto the circular saw, D-1191-12 reported confusion, followed by intense mental distress and unprompted verbal denial of three previous murders. SCP-1191 cast aside, slightly chipped upon impact with floor. Test 4 Date: ██-██-████ Subject: Personnel D-1191-44, D-1191-67, and D-1191-108 Procedure: The three Class-D personnel were instructed to touch SCP-1191 simultaneously. Results: All three personnel experienced convulsions, denying previous episodes. Interestingly, the episodes denied were not in any case those that led to the individual's initial incarceration. Test 6 Date: ██-██-████ Subject: Personnel D-1191-13 Procedure: D-1191-13 was directed to move SCP-1191 from chamber corner with 0.5 m iron tongs. Results: Upon grasping SCP-1191 with tongs, D-1191-13 reacted violently, insisting upon alternate history induced by the object. Under extensive questioning, D-1191-13 demonstrated knowledge consistent with Security Clearance Level 1/1191, insisting that he was a research assistant "and a law-abiding citizen". Test 10 Date: ██-██-████ Subject: Personnel D-1191-53 Procedure: D-1191-53 was seated in Control Booth 75, given access to a standard Foundation remote-controlled exploratory drone, and instructed to transfer SCP-1191 to a new containment locker with better preservative facilities. Results: At the moment of contact between the drone's manipulators and SCP-1191, D-1191-53 abruptly became confused and distressed, verbally denying involvement in the preschool bombing for which she was incarcerated. Further questioning was unsuccessful, revealing only that the subject now experiences considerable distress at the memory of child casualties. Note: Dr. ████████ was reprimanded for permitting Class-D personnel contact with exploratory drones, which are equipped with easily-weaponizable sampling tools, and for allowing direct personal contact between Class-D personnel and Foundation operatives. « SCP-1190 \| SCP-1191 \| SCP-1192 » ‡ Licensing / Citation Cite this page as: "SCP-1191" by LooksLikeSnow, from the SCP Wiki. Source: https:// scpwiki.com/scp-1191. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxmind-affectingsafescptree page revision: 21, last edited: 20 Oct 2022 21:36 Edit Rate (+101) Tags Discuss (49) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1192 rating: +706+–x Item #: SCP-1192 Object Class: Euclid Special Containment Procedures: SCP-1192 is contained in a dedicated aviary and is to be provided a diet of fruit supplemented with protein and vitamin additives, as it refuses to consume seeds and insects that are a part of a normal diet for its species. SCP-1192 is to be provided with several pencils and pages of paper to allow it to communicate. In the case that SCP-1192 becomes belligerent, mild sedatives may be introduced into its food and water supply under close veterinary supervision. Description: SCP-1192 is a juvenile male Gang-gang Cockatoo (Callocephalon fimbriatum), a species normally native to south-east Australia, approximately 33.5 cm in length. SCP-1192 appears to be sapient and exhibits intelligence and common knowledge consistent with that of a human child between the ages of six (6) and eight (8). SCP-1192 is unusually disheveled as it appears to be unable or unwilling to preen itself, and has difficulty flying despite being essentially healthy and uninjured. Close examinations have shown a slight, healed-over contusion on the back of SCP-1192's head, but no internal injury or damage was ever found. SCP-1192 was discovered and brought into containment by Agent ████ █████ on ██/██/██, who at the time was embedded as an undercover agent in the Newark Police Department in New Jersey. It is believed at this time that SCP-1192 began following Agent █████ and trying to attract his attention because of the perception of an authority figure in police uniform. Agent █████ became suspicious due to SCP-1192's unusual species and erratic behavior and sent a request for assistance; a Foundation containment team was dispatched and was able to detain SCP-1192 and bring it to Site ██ for examination. Addendum 1192-01: Experiment Log 1192-01 Shortly after initial containment, experimentation was performed in which SCP-1192 was introduced to a multitude of objects in a controlled environment in order to deduce its abilities. Upon being introduced to the testing chamber, SCP-1192 immediately gravitated to a pencil and paper and began to attempt to write crude sentences. At this point, Dr. █████████ was brought in in an attempt to communicate with SCP-1192. SCP-1192: (writes "who ar u" [sic]) Dr. █████████: I am Dr. █████████. I'm here to speak with you. Who are you? SCP-1192: (writes "timmi" [sic], followed by "wher am I" [sic]) Dr. █████████: You're at a medical center, Timmy. A hospital. Do you know what happened to you? SCP-1192: (writes "no", then "i wana go hom" [sic]) Dr. █████████: Where do you live, Timmy? After several minutes and with some difficulty, SCP-1192 managed to write down an address for a residential home in ██████████, Montana. Undercover agents sent to the specified residence determined that the location is inhabited by Mr. and Mrs. ███████ as well as their son, Timothy ███████, age 7. Agents assigned to monitor the family have noted nothing out of the ordinary with the family thus far. Addendum 1192-02: Researcher Note As SCP-1192 is unable to manipulate objects with enough coordination to play with the video games it requested and it shows little interest in the other toys we have offered it, it has taken to scribbling and making crude drawings with the materials we have provided. A list of notable materials are as follows: Several pages of unrelated words, presumed to be writing practice. Several pages of crude drawings, including race cars, airplanes and fictional animals and monsters. A single page with the words "wy am I a bird" [sic] as well as several more indecipherable sentences. A drawing of what appears to be a small child holding the hands of two adults. The child is scratched out and the paper is ripped. The reverse side of the page has the words "i wan my mom" [sic]. A single page with 126 instances of the word "mom" and 76 instances of the word "home". Dr. █████████ Senior Observer « SCP-1191 \| SCP-1192 \| SCP-1193 » ‡ Licensing / Citation Cite this page as: "SCP-1192" by Aelanna, from the SCP Wiki. Source: https://scpwiki.com/ scp-1192. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxairbornealiveanimalartisticbirdeuclidsapientscp page revision: 20, last edited: 21 Oct 2022 09:06 Edit Rate (+706) Tags Discuss (97) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com • • • • • Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1193 rating: +916+–x Item #: SCP-1193 Object Class: Safe Special Containment Procedures: The borehole containing SCP-1193-01 is to be capped with a tungsten steel grate containing a locking 2.5cm endoscopy aperture. At 48-hour intervals, the borehole is to be endoscopically inspected to a depth of 4km for further manifestations of SCP-1193-01. Seismographic monitoring devices are posted at 2, 7, and 11 kilometer depths alongside the SCP-1193-01 borehole. Seismic readings consistent with subterranean movement are to be reported immediately to Site Director Iqbal. In the event of subterranean containment breach, containment staff are to execute Protocol 473a, severing SCP-1193-01 below the fifth elbow and backfilling remaining portions of the borehole with pressurized concrete. The basement containing SCP-1193 is to be monitored at all times by a Foundation interrogator. SCP-1193-02 is to be answered on or before the third ring; interrogator should attempt to elicit self-directed responses from SCP-1193-01. Responses which implicate size, body plan, location, or further manifestations are to be recorded in Document SCP-1193-2-LTR. Description: SCP-1193-01 is a genetically normal human arm of unusual length, located in a drainage pipe inside the basement of a telephone switching station in Scottsdale, Arizona. Ten centimeters below the drainage grate, the arm terminates in an unremarkable human hand of indeterminate gender. Upon initial examination, the arm was believed to extend through the drainage pipe to a depth of 35 meters. Subsequent endoscopic investigation demonstrated that the arm extends to at least a depth of 71 kilometers, passing without apparent difficulty through the Mohorovičić discontinuity and the upper mantle, with regularly spaced elbows every four kilometers. Elbows below a depth of 26 kilometers are slightly retroflexed to accommodate a nine-degree southward bend in the drainage borehole. Continued endoscopic investigation into the SCP-1193-01 borehole is suspended due to presently-intractable engineering constraints. Communications via SCP-1193-02, mostly concerning SCP-1193-01's oven and refrigerator, indicate that SCP-1193-01 may lack conventional thermoreception, and that it is experiencing no substantial discomfort despite borehole temperatures in excess of 674 degrees Centigrade. SCP-1193-02 is a GPO 746 telephone, topaz yellow, manufactured in 1971. Its dimensions preclude it having been delivered to the site via the borehole; containment team's present working theory is that it was installed topside for the purpose of communicating with SCP-1193-01. Installation was conducted by unknown parties, by unknown means, for unknown purposes. The rotary dial has been glued into place, rendering it unsuitable for outgoing phone calls. It is attached to a conventional twisted- pair line which enters the drainage pipe containing SCP-1193-01 and descends parallel to SCP-1193-01 until endoscopy is no longer practicable. At between 0838 and 1034 hours Mountain Standard Time each weekday, the phone will ring five times. If answered, an unidentified voice will willingly engage in conversation with SCP personnel. The voice on the other end of the line invariably claims to be a human being, and regularly mistakes the individual on the other end of the phone for an authority figure. Interrogation to date has therefore been relatively uncomplicated. Notable parallels exist between information elicited via SCP-1193-02 and demonstrable facts about SCP-1193-01. To date, anomalous information received via SCP-1193-02 has included: References to human features, but an anomalous body plan. References to insensitivity to heat or cold. References to 'a cousin' or other relative, who will soon arrive to 'pick [him] up.' References to discomfort and boredom at confinement. References to minor seismic events along the Little Chino fault complex. References to discomfort at having a limb or other body part restrained, as by handcuffs, a jelly jar, a pipe, a cast, or in one instance, a gopher hole. At present, data related to SCP-1193-01's size, physical form, and body plan beyond the parts visible through endoscopic investigation should be regarded as provisional. For contingent protocols and physiological testing data, consult Document RTMR-Delta. Transcript SCP-1193-2-LTR-7: <Begin Recording, 03/24/2008, 9:48 AM> Dr. Iqbal: Good morning. And who may I ask is calling? SCP-1193-01: David. Dr. Iqbal: And where are you now, David? SCP-1193-01: [Inaudible.] Sorry — who is this? Dr. Iqbal: Dr. Hassan Iqbal, director of research. SCP-1193-01: Oh. From the hospital? Dr. Iqbal: [Pause] That's right. SCP-1193-01: So, when does the cast come off? Dr. Iqbal: I'm sorry? SCP-1193-01: The cast. On my bottom arm. When does it come off? Dr. Iqbal: I'm to understand you've got… a cast… on your bottom arm? I don't understand. Which arm is that? SCP-1193-01: The bottom one. Can you take it off? I've already been in the hospital for three months. Seems like it should be about time. Dr. Iqbal: You say you're in a hospital now? SCP-1193-01: You should know. You're the one who put me there. Dr. Iqbal: I think you must have me mistaken for someone else. SCP-1193-01: Look, if you can't help me, put someone who knows what he's talking about on the line. Dr. Iqbal: I'm afraid I'm the only one here. SCP-1193-01: Fine. Just tell me when someone competent gets to the phone. CALL TERMINATED <end recording> Transcript SCP-1193-2-LTR-8: <Begin Recording, 03/24/2009, 9:52 AM> • • • • • • SCP-1193-01: God damn it. God damn it. God damn it. Dr. Iqbal: Hello? SCP-1193-01: Hello? Can you hear me? Dr. Iqbal: Who is this? Where are you? SCP-1193-01: [Inaudible.] For Christ's sake, I'm stuck in the stove here, man. Get the fire department. Dr. Iqbal: The stove? Are you … I'm sorry, the stove? SCP-1193-01: Yeah, the stove. I went in here to get out some cakes, and I can't get back out. Dr. Iqbal: You … went in the stove … to get out some cakes? Am I hearing you correctly? SCP-1193-01: It's a tight fit here. Jesus. Dr. Iqbal: Are you … is the temperature uncomfortable? SCP-1193-01: The what? Dr. Iqbal: Temperature. Are you in pain? SCP-1193-01: I have no idea what you're talking about. Can you call the goddamn fire department? My back. Jesus Christ, my back. Dr. Iqbal: I'm the only person here. SCP-1193-01: I can't take it anymore. Fuck. I'm sorry. I'm calling my cousin now. SCP-1193-01: I'm so sorry. This isn't my fault. CALL TERMINATED <end recording> « SCP-1192 \| SCP-1193 \| SCP-1194 » ‡ Licensing / Citation Cite this page as: "SCP-1193" by ophite, from the SCP Wiki. Source: https://scpwiki.com/ scp-1193. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxapplianceauditoryextremityhumanoidreviewers- spotlightsafescpsubterraneanthermal page revision: 34, last edited: 21 Oct 2022 08:08 Edit Rate (+916) Tags Discuss (148) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1194 rating: +155+–x Item #: SCP-1194 Object Class: Safe Special Containment Procedures: SCP-1194-1 is to be kept in a secured storage locker in Research Sector-12 when not in use. Deactivation of SCP-1194 is to be initiated through the termination of the active SCP-1194-2-T subject or, if more convenient, the SCP-1194-2 instance. Testing Chamber 13-A (a standard humanoid containment unit) and 13-B (modified to serve as a stable) are to be maintained for the purposes of experimentation involving SCP-1194. Please see Document 1194-C for extensive information on standard testing procedure. Description: SCP-1194 consists of two parts: SCP-1194-1 and SCP-1194-2. SCP-1194-1 is a small device (roughly 3 cm × 1 cm × 4 cm), consisting of a speaker attached to a pull-string (roughly 6cm of which is exposed while not being activated, with an actual length of roughly 11cm) and a plastic case; analysis of the speaker, however, shows it to have at some point been rendered inactive despite the remainder of the mechanism being functional. Upon being protracted, the string will slowly retract to its original length at a rate proportional to the length removed. When a female subject pulls the string until an additional 3cm is exposed, SCP-1194 is activated, causing the manifestation of an SCP-1194-2 instance.1 Partial retraction, or retraction by a male subject, does not have this effect. SCP-1194-2 is an organism, largely similar in physiology and morphology to an adult member of Equus ferus caballus, with an average height of 139cm. Upon the activation of SCP-1194, SCP-1194-2 will appear on the nearest suitable flat surface,2 provided such a space is present within 30 metres of the device; otherwise, activation will fail to occur. Instances have displayed various sizes, breeds and both sexes, and are notable for various biological irregularities – including the presence of betacyanins, pararosaniline and other pigments not usually found in mammals on their coats, typically causing a mild purple or pink colouration. Specimens do not synthesise or otherwise produce these chemicals, causing this colouration to fade over time. The death of an SCP-1194-2 specimen, that of the relevant SCP-1194-2-T subject, or the string of SCP-1194-1 being pulled during an active state, will cause the current instance of SCP-1194-2 to disappear. Should the lattermost situation occur, a new specimen will appear provided the conditions for this occurring are met. Upon disappearing, the volume previously occupied by the specimen will be replaced by a gas consistent in composition and density with standard tropospheric air. The following is a copy of the text found on a torn document recovered with SCP-1194-1 (see below). A section of the document has been rendered illegible. Further investigation has revealed no information regarding the object’s relation to Group of Interest "Dr. Wondertainment". Cowgirl, looks like you got your very own Wonder-Pony!TM Dr. Wondertainment’s Wonder-Pony!TM is a fun, educational toy, which will help teach any horse-loving girls things like how to take care of a sick horse, the importance of care and attention, and how to feed a horse. All without having to take care of the muck! Not only that, but your pony will provide constant companionship and friendship. Your very own Real Wonder-Pony!TM can even t[SECTION DAMAGED] […]ony!TM is the intellectual property of Dr. Wondertainment. Dr. Wondertainment assumes no responsibility for physical, mental or emotional harm caused by the misuse of Dr. Wondertainment’s Wonder Pony! TM if disassembled or otherwise damaged. Dr. Wondertainment takes no responsibility for the destruction of life created by Dr. Wondertainment, or damage caused to said life after creation. For more information, please contact the public relations department currently associated with Dr. Wondertainment. Specimens of SCP-1194-2 behave in a manner normal for a horse of their estimated age (typically four to five years, except in three – at time of writing – known cases: please refer to documentation regarding SCP-1194-2-5, -9 and -13, all of which were significantly below the average age of other specimens); several notable anatomical and physiological distinctions are, however, present: Firstly, specimens are effectively incapable of vocalisation; examination has revealed no direct cause of this, as no features of relevant tissue or mouthparts seem to function in a preventative manner. Experimentation involving the placement of specimens in situations which would cause distress has failed to provoke any vocal reaction, despite successfully doing so in the cases of normal horses. Specimens do not excrete faeces or urine, despite intaking and digesting food normally. Specimens do, however, maintain a relatively constant mass if well-fed, and will lose mass if not provided with food: how this is regulated is not currently known. Extended lack of contact with their relevant SCP-1194-2-T subject has invariably resulted in several severe symptoms occurring in SCP-1194-2 specimens, usually becoming noticeable after four days without physical contact, and substantially affecting behaviour after seven to eight. This has, in all known cases, followed the same progression: heart rate first decreasing at a constant rate, followed by the symptoms of prolonged nutrient deprivation, and the specimen behaving in a way consistent with that of horses experiencing illness and starvation. Death will occur at fourteen days – the exact cause of this is not known due to the disappearance experienced by SCP-1194-2 upon dying. The unusual pigments present within the coat of specimens will regularly (i.e., once every 3-12 months) be replaced with green cadmium dye, eventually causing acute poisoning from absorption, over several days. This process is gradual, marked by a decrease in the intensity of the previous colouration as the former pigment reduces in concentration while the cadmium increases, and typically takes two to three days to complete. While this is rarely fatal, the symptoms typically associated with exposure to the toxin manifest by the time the dye’s concentration stops increasing. Continued exposure to SCP-1194-2-T appears to lessen the • • • • severity of these symptoms, and the substance will disappear from the body of specimens over the course of several minutes under a week after initially appearing. When this occurs, the pigment previously removed will return, often to the concentration possessed during the initial manifestation of the specimen. In all instances of this occurrence, specimens have made a full recovery with provision of appropriate treatment. SCP-1194-1 was originally recovered from a house in ███████, England, after an automated search of local police files regarding the suicide of one ████████ ██████. The remains of a ceramic and plastic casing resembling a generic horse of no discernible breed, apparently broken by extreme fall damage, were also found within a metre of the object. Said casing’s interior displayed similarity to that of toys designed to accommodate pullstring speakers. Approximately 20% of the casing could not be located, and standard post-acquisition protocol was later completed. Addendum (Refer to Endoscopy Reports 1194-█ through █): Extensive analysis has demonstrated a consistent structural abnormality in the vocal folds of SCP-1194-2 specimens. Research is ongoing. Update 20██-██-██: The vivisection of SCP-1194-2-█6, -█7 and -█8 has revealed their vocal apparatus to bear a notable similarity to that of an adolescent human female, despite the fact that both SCP-1194-2-█6 and █8 were male. It is unknown if this represents the entirety of the organisms produced by SCP-1194: exhaustive testing is currently being planned. Footnotes 1. The relevant female is at this point considered SCP-1194-2-T, and is assigned a specific number (e.g., SCP-1194-T-03) 2. Note: “suitable flat surface” refers to any solid surface with a great enough area to accommodate a standing, full-grown horse, without any inhibiting factors such as the presence of liquid or solid matter, extreme ambient temperature, etc. which would cause severe injury to or restrict the movement of the specimen. « SCP-1193 \| SCP-1194 \| SCP-1195 » ‡ Licensing / Citation Cite this page as: "SCP-1194" by Bunton, from the SCP Wiki. Source: https://scpwiki.com/ scp-1194. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxaliveanimaldr-wondertainmentequinesafescptoy page revision: 32, last edited: 21 Oct 2022 08:23 Edit Rate (+155) Tags Discuss (11) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License • Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1195 rating: +256+–x Item #: SCP-1195 Object Class: Safe Special Containment Procedures: SCP-1195 is to be stored in a standard Safe-class storage locker. The locker is to be locked by keypad, the combination known to the current head researcher, and changed in the event of a new researcher. SCP-1195 is to be placed on a standard lecture podium for ease of reading, unless being dictated to or otherwise being used in experimentation. Personnel are instructed to cease any oration that is seen to provoke an unintended negative response. Description: SCP-1195 is a leather-bound book (approx. 25cm x 17cm) of indeterminate origin and age; carbon-dating on the pages has given inconsistent results, and forensic examination of the leather matches no known species. It seems to have a variable number of pages, averaging approximately at 400. SCP-1195's anomalous properties become apparent whenever it is opened. Most often, the first page is found blank, and after a moment, the object will attempt to communicate via written text "bleeding" onto the page. It will always initially communicate in Euskara, but upon being responded to in any other language, it will continue to interact with the spoken/written one instead. Its method of instantaneously understanding and learning new languages is unknown, and recommended for further study. SCP-1195 has demonstrated an ability to converse in Braille in experiments with blind test subjects. Upon being activated in this way, SCP-1195 will make one of various requests (see document 1195-W37 for full list of requests); the most common request is to be told a story. When a story, allegory or other similarly descriptive speech is directed towards it, SCP-1195 will begin transcription. If the story is not told in a general readable format, SCP-1195 will reformat without noticeable loss of speed in the process. If allowed pauses during the story, SCP-1195 will offer criticism, encouragement, or other comments, depending on the oratory skill, imagination or interest of the speaker. Generally, SCP-1195 is willing to continue this process indefinitely, creating new pages as needed for extremely long stories. The maximum number of pages observed has been 3189, at which point SCP-1195 stated that it was "bored" and that the experiment in progress was "stupid". SCP-1195 then closed itself, and upon being re-opened was observed to only have 120 pages; however, whether this was due to dissatisfaction with the experiment, or with the quality of the narrative, is unknown. SCP-1195 has no direct means of locomotion; however, it can close itself with up to 15 N of force, and turn its own pages. It generally allows itself to be handled by anyone, save those who have physically damaged it or angered it previously. All attempts to coax SCP-1195 into divulging information about its origins, history or other personal data have met with failure, as SCP-1195 states that it would need "permission" to share its personal history. Stories transcribed into SCP-1195 will in most cases not remain long, with the exception of stories of subjectively high quality or substantial length, which may stay for up to █ weeks. Most often, any previous story is erased as soon as a new subject arrives. SCP-1195 appears to remember certain individuals, and, based on previous story quality and other experiences, will show varying levels of excitement and cooperation during subsequent sessions. Attempts to damage the book have met with varied results. It is clear that cosmetic and superficial damage to the exterior is lasting. As such, experiments must adhere to a guideline that they do not cause further damage to this area. The pages, however, seem able to be replicated with no upward limit. SCP-1195 generates additional pages as needed. In the event that a page is physically removed from the object, text fades from the excised page immediately, and kerning on the remaining pages is adjusted so that the original full text is accommodated. Writing into the book has the same communicative results as speaking orally during initial interaction. Once the recitation process has begun, however, text handwritten in will be absorbed after a moment, and responded to. For example, a written-in note about SCP-1195's choice of formatting a particular paragraph will be considered, and either disregarded, or the format changed. Document 1195-W37: Requests made by SCP-1195, as of ██/██/20██ "Tell me a story" (8985 times) "Tell me a better story" (1158 times) "No kissy stuff" (972 times, in response to narratives featuring erotic or romantic content) "Tell me a joke" (604 times) "Leave me alone, I'm sleepy" (411 times) "Leave me alone, you're stupid" (293 times) "Come back! I'll be good! I promise!" (74 times, made in response to reading sessions being aborted, or to certain readers being replaced mid-session) "I want my mommy." (1 time) « SCP-1194 \| SCP-1195 \| SCP-1196 » documentlanguagenarrativerewritesafesapientscp page revision: 25, last edited: 02 Oct 2022 07:17 Edit Rate (+256) Tags Discuss (45) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. • • • • • • • • View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1196 rating: +202+–x Item #: SCP-1196 Object Class: Safe Special Containment Procedures: The building formerly housing the ███████ █████████ Back Clinic and SCP-1196 has been repurposed as a Foundation front business. The entrance to the basement has been replaced by a reinforced steel door and is to be triple locked. The unlocking codes are only available for access by level 3 personnel and higher. If SCP-1196's area of effect appears to have shifted in any way, the Site Director should be contacted immediately. Under no circumstances, unless explicitly for testing, are chairs allowed within SCP-1196. Description: SCP-1196 is the basement of the former ███████ █████████ Back Clinic, located in ███████, ███████. The basement walls and ceiling are all composed of concrete, with several support pillars at various points in the room. The floor is unfinished. Fluorescent lighting tubes line the ceiling, but only three (3) of them remain in working condition. SCP-1196’s anomalous properties only arise when a chair1 is introduced to it. As soon as the legs of a chair are allowed contact with the floor of SCP-1196, it becomes an instance of SCP-1196-1. SCP-1196-1 is the designation given to any chair under the effect of SCP-1196. Instances of SCP-1196-1 appear to gain sentience and the ability to move independently, either by shuffling across the floor, or — in the case of folding chairs — rapidly opening and closing their legs. Chairs removed from SCP-1196 lose all anomalous properties. Instances of SCP-1196-1 are able to speak in English through unknown means; these vocalizations consist of short, clipped sentences spoken in a high-pitched, "squeaky" voice. Instances of SCP-1196-1 will only vocalize when a human being is inside SCP-1196, regardless of their distance from the subject. Vocalizations are usually commands that refer to the spinal health and posture of the subject. However, these commands are not based on the subjects’ actual spinal health, with instances of SCP-1196-1 saying the same sentences regardless. + Sample SCP-1196-1 Phrases “Stand up straight!” “Don’t slouch!” “Fix your posture!” “Slouching causes scoliosis!” “I said stand up straight.” “Straight.” If a human being spends more than 30 minutes within SCP-1196, all instances of SCP-1196-1 will fixate upon the individual, hereby referred to as the subject. Instances of SCP-1196-1 will follow the subject around and instruct them more clearly on their spinal health. If more than one human being is within SCP-1196, instances of SCP-1196-1 will fixate on a random individual. Exiting SCP-1196 negates this effect. If the subject remains inside SCP-1196, several changes will occur in the current SCP-1196-1 population. As time elapses, instances of SCP-1196-1 will grow more active and vocalize more often, and the voice used will become deeper and louder. If the subject remains within SCP-1196 for approximately 60 minutes, instances of SCP-1196-1 will vocalize rough commands and statements about the subjects’ spinal health in a more negative light, frequently repeating phrases such as “Awful posture” in threatening tones. After approximately 80 minutes, instances of SCP-1196-1 will begin to assault the subject; methods of attack include ramming, tripping, stabbing (with chair legs), and crushing. The population of SCP-1196-1 will repeat these actions until the subject either escapes or is killed. However, instances of SCP-1196-1, despite being non-sapient entities, appear to display remorse for these actions, vocalizing various apologetic phrases. Individual instances of SCP-1196-1 have attempted to move or bury the bodies, often times trying to utilize tools like shovels and brooms, to little effect. + Sample “Apologetic” Phrases: “We’re sorry.” “Apologies.” “I’m sorry.” “Tried helping!” “Forgive?” Footnotes 1. Hereby defined as an object with four legs and a seat that is designed for sitting in; rolling chairs are not affected, although rocking chairs are. « SCP-1195 \| SCP-1196 \| SCP-1197 » ‡ Licensing / Citation Cite this page as: "SCP-1196" by BlindspotFuzz, from the SCP Wiki. Source: https:// scpwiki.com/scp-1196. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxartifactautonomouslocationsafescp page revision: 20, last edited: 21 Oct 2022 08:17 Edit Rate (+202) Tags Discuss (51) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1197 rating: +243+–x Item #: SCP-1197 Object Class: Euclid Special Containment Procedures: SCP-1197 is to be fitted with a Foundation issue keycard lock designed to match neighboring units. Management has been instructed to inform both staff and guests that SCP-1197 is indefinitely inaccessible. Two armed personnel are to be incorporated into the civilian staff in the security office. Any subjects emerging from SCP-1197 are to be detained and administered medical and psychological treatment before being interviewed. Following an active session SCP-1197 is to be thoroughly searched and cleaned with the entrance door secured open. Any anomalous items and bodies are to be removed and studied. SCP-1197-1 is not to be manipulated at any time outside of testing. Description: SCP-1197 is hotel suite ███ in [REDACTED], containing a bedroom area, bathroom, and typical furnishings including a television, mini-fridge, and telephone. The windows on the far wall of the bedroom cannot be opened and the walls, floor, and ceiling cannot be damaged or breached by any known means. When viewed from through the windows from outside SCP-1197 appears as a clean and unoccupied room at all times. SCP-1197 can be occupied for any amount of time and freely vacated, provided the occupant does not open SCP-1197-1. SCP-1197-1 is a doorway in the western wall of SCP-1197. Although it appears to connect to the adjacent suite, the corresponding door in room ███ cannot be opened. SCP-1197-1 remains locked unless the entrance door to SCP-1197 is closed, at which point SCP-1197-1 can be opened. Opening SCP-1197-1 will reveal an identical version of SCP-1197, including any current occupants, who have opened their version of SCP-1197-1 at the same moment. New instances of subjects exhibit accurate knowledge in response to questions of identity, and act in a similar manner. Posthumous testing reveals no biological discrepancies. SCP-1197 has demonstrated the ability to spawn items during an active session, out of view of any occupants. Utilities, with the exception of the telephone, continue to function, but occasionally experience outages. During an active session the entrance door to SCP-1197 will no longer open and cannot be breached from either side. Should 1 instance of each occupant expire, SCP-1197-1 will close and the entrance door will open for whichever room is currently occupied. To date all recorded deaths within SCP-1197 have resulted from homicide. Addendum: Note: The Foundation became aware of SCP-1197 4 days into Incident 1197/3. Interviews with hotel staff and local authorities provided information regarding previous incidents. For clarification purposes, surviving subjects are designated -1, -2, etc. while their duplicates are designated -A, -B respectively. Show Incident Logs Subject: █████ ████████ Duration: Approximately 16 hours Subject-1 failed to check out of SCP-1197. Hotel staff could not open door, authorities notified. Before police arrived subject exited SCP-1197, appearing distressed and acting violently towards anyone approaching him. A battered body similar in appearance to the subject was discovered in SCP-1197. Subject arrested and interrogated before committing suicide in police custody. Interrogation logs provided rough details of an SCP-1197 active session, during which the subject-1 accused subject-A of lying about his identity, denied the reality of the situation, and attempted escape. Eventually the subject-1 subdued and tortured subject-A to gain additional information and/ or freedom. Subject-A expired from inflicted injuries, at which point SCP-1197-1 closed and the entrance door opened. Posthumous DNA testing revealed a match between the subject-1 and subject-A. Subject: ███████ ████████ Duration: Unknown A body matching subject-1 was found in SCP-1197 by cleaning staff at approximately 12:15pm the day after subject-1 checked in. A police investigation determined the cause of death to be asphyxiation using a leather belt matching the one worn by subject-A. Time of death estimated at 9:30am. Hotel security video and front desk logs show subject-1 exiting room and checking out at 9:37am. Subject-1's current location unknown. Subject: ██████ and ████████ ████ Duration: Approximately 45 days Before the Foundation could secure the site subject-1 (male) and subject-2 (female) activated SCP-1197. On-site personnel responded to the re-opening of SCP-1197 to discover subject-1 assaulting subject-2. Subject-1 detained, subject-2 transported to nearest hospital under guard. Interview reveals subjects to be a married couple. Subject-1 opened SCP-1197-1 while unpacking, discovering subject-A and subject-B. After a few hours of panic and argument subject-2 and subject-B were able to calm their husbands and all 4 agreed to rest and await rescue. Subject-B discovered wrapped sandwiches in their mini-fridge which hadn't been there previously, sharing them amongst all 4 subjects. The fridge replenished every day at first, but gradually produced food less and less frequently. Over the following weeks tension grew between the couples until they decided to keep SCP-1197-1 closed and check in daily. Eventually subject-A claimed the fridge ceased producing food, resulting in a violent altercation, after which SCP-1197-1 was closed and barricaded from both sides. Several days later subject-1 awoke to find subject-2 missing. Forcing SCP-1197-1 open subject-1 discovered subject-A in bed with subject-2 and subject-B. All 3 claimed innocence to accusations of infidelity. Subject-1 assaulted subject-A, leading to the death of subject-A and subject- B. SCP-1197-1 closed and entrance door opened. 2 bodies were recovered for study. Subject-2 expired from injuries before being interviewed. Subject: D-1916, a 28yr. old male convicted of a gang-related homicide Duration: Approximately 9 days D-1916 instructed to enter SCP-1197, wait until the entrance door was closed and open SCP-1197-1. D-1916 equipped with audio and video recording devices. Remote feeds were lost when SCP-1197-1 was opened. Upon exiting SCP-1197 D-1916-1 attempted to escape the hotel before being detained. D-1916-1 described meeting D-1916-A and exchanging questions until both accepted their situation. D-1916-1 and D-1916-A attempted escape, but were unable to breach doors and windows, or contact anyone via telephone. Over the next week increasingly elaborate plans were enacted but all met with failure as various utilities such as power, water, and air conditioning began failing for long periods. Arguing intensified until D-1916-1 discovered an electric iron in the closet and bludgeoned D-1916-A to death. SCP-1197-1 closed and the entrance door opened. Body, iron and 2 recording devices recovered for study. Recovered recordings show a clean, quiet and unoccupied room matching that seen through the windows. The videos follow the movement of each subject, but even when pointed at each other or at mirrors do not show the subjects or recording devices. Subject: D-985, a 24yr. old male convicted of three related homicides Duration: 5 minutes D-985 armed with a loaded pistol and fully informed about the nature of SCP-1197. D-985 instructed to enter SCP-1197, wait until the entrance door was closed and open SCP-1197-1. Entrance door opened minutes later, revealing D-985-1 leaning against armchair with a gunshot wound in the side, facing a closed SCP-1197-1. D-985-1 ordered by armed personnel to drop pistol and lay face down. D-985-1 complied. D-985-1 described opening SCP-1197-1 and being shot before returning fire and presumably terminating D-985-A. Personnel report not hearing any gunshots or other noises from SCP-1197 until entrance door re-opened. D-985-1 escorted from SCP-1197 and treated by medical personnel. Subject: D-5482, a 40yr. old female convicted of a domestic homicide Duration: 38 hours D-5482 instructed to enter SCP-1197, wait until the entrance door was closed and fully explore the room. After 38 hours entrance door opened but D-5482-1 did not exit. Security personnel entered SCP-1197 and discovered D-5482-1 sitting on the bed cradling D-5482-A, who had expired from a gunshot wound to the temple. A single pistol was found on the floor which had not been issued to the subject. D-5482-1, body and pistol removed from SCP-1197. D-5482-1 was calm and refused to describe her experience, explaining only that she had "dealt with her issues." Subject: Dr. Harrison Duration: Ongoing - 96 days as of most recent project report Following extensive psychological examination, Head Researcher Dr. Harrison was cleared to activate SCP-1197 for direct study. Subject provided with a standard survival pack, 30 days of rations and 1 week's worth of emergency drinking water. Various additional supplies approved, including clothing, books, writing materials, and board games. « SCP-1196 \| SCP-1197 \| SCP-1198 » ‡ Licensing / Citation Cite this page as: "SCP-1197" by Ink Asylum, from the SCP Wiki. Source: https://scpwiki.com/ scp-1197. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxbuildingectoentropiceuclidindestructiblelocationscp page revision: 15, last edited: 21 Oct 2022 08:17 Edit Rate (+243) Tags Discuss (66) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1198 rating: +123+–x Item #: SCP-1198 Object Class: Safe Special Containment Procedures: A single copy of SCP-1198 is stored in the High Security Data server of Site 19. It is stored in a password-protected subsystem that is only accessible by Level 3 or higher researchers assigned to SCP-1198. When used for experimental procedures, all personnel involved other than the intended subject are to wear hearing protection sufficient to block sound up to 70 dB in volume. SCP-1198 is only ever to be played in a sound-proofed room designed to minimize echoes. Subjects affected by SCP-1198 are to be instructed to communicate only via written or typed text, preferably through a touchscreen, so as to minimize sound produced. Subjects are not allowed access to any piercing instruments or other objects which could be repurposed to perforate the eardrums of the subject. Requests for authorization to commence testing on individuals who are fluent in sign language but retain full hearing are pending. Description: SCP-1198 is a sound file lasting 37.2 seconds that is encoded in the Waveform Audio File Format (.wav). To unaided human hearing, it appears to be a blank or silent file. Audio analysis reveals a high-frequency soundwave which is at the upper limit of normal human hearing. When transposed to a lower frequency, the sound file plays a complicated non-repeating sequence of atonal screeches, arrhythmic pauses and pure tones. Although every subject who hears the transposed sound file describes it as mildly to moderately unsettling, it only displays its anomalous properties when played at its original frequency. Copies of the original file retain the anomalous property, but converting the file to .mp3 or any other audio file format eliminates the anomalous property. After being exposed to the entirety of SCP-1198 at any volume between 35 dB and 65 dB, all subjects develop a unique form of auditory hallucinations. Beginning approximately 10 hours after initial exposure, subjects will begin to hear any sounds directly caused by them start to echo. This includes, but is not limited to, sounds such as speech, their own footsteps, the engine noise of a vehicle they are operating, and internal bodily sounds such as breathing or stomach gurgles. This effect does not include externally caused sounds such as the speech of others, music, or naturally occurring echoes, all of which they hear normally. These anomalous echoes initially fade within a few moments, but over the course of approximately 48 hours, the duration of the echoes increases to the point that they no longer disappear. Affected subjects have described this in a variety of ways, but the echoes apparently neither increase nor decrease from the volume of the original sound, and sounds layer over each other such that the subject is constantly hearing all the echoes simultaneously. Although SCP-1198 does not affect any individual who is incapable of hearing, whether via sound dampeners or independent deafness, affected subjects who are later deafened continue to hear any preexisting echoes. All affected subjects will eventually begin to display psychological abnormalities consistent with sensory overload, as well as generalized phonophobia and a heightened aversion to any activity on their part that would produce sound. Addendum: Once a subject has acquired an indeterminate amount of layered echoes, they begin to experience secondary auditory hallucinations. Subjects who have progressed to this stage and are still willing and able to communicate textually report that the echoes start to intermittently amplify and distort each other such that the resulting interference pattern resembles speech. This new source of speech is internally consistent and identical across all subjects, whose reports indicate that the speech is simultaneously transmitted to all affected subjects. Samples are transcribed below. "The only thing you have to fear is [garbled] alone and afraid, naked before the [garbled] that made you." "Elephants squash ants, don't they?" "Pity not the reaper man. Pity yourself." "fish lizard rat monkey man [garbled] end forever" "Join cacophony. Things die. Voices rise." « SCP-1197 \| SCP-1198 \| SCP-1199 » ‡ Licensing / Citation Cite this page as: "SCP-1198" by Drewbear, from the SCP Wiki. Source: https://scpwiki.com/ scp-1198. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxacousticauditorycognitohazardhallucinationsafescpsensory page revision: 16, last edited: 21 Oct 2022 08:19 Edit Rate (+123) Tags Discuss (33) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1199 rating: +157+–x SCP-1199; Area-25 industrial laboratory Item #: SCP-1199 Object Class: Safe Special Containment Procedures: SCP-1199 is housed in its original container in a medium security containment locker; accessible for research purposes by Level 2 or higher Area-25 research personnel. Description: SCP-1199 is a can of gloss house paint originating from an unknown manufacturer. Although aged, the item is in fair condition. The can is filled to 50% of volume with a beige liquid which resembles acrylic paint. Throughout testing it was noted that this level does not fall unless the item is open and inverted. Early testing revealed trace biomass within the liquid. When spread onto a surface as paint, the liquid takes on a slight red tone which fades as it dries. The final dry color is a pale white. Within the first hour of drying, treated surfaces will begin to radiate a small amount of heat. Soon after, the surface will become slightly glossy due to slight secretion of sebaceous oil. Microscopic examination shows structure identical to human epidermis. All samples 0.10 mm or greater thickness contained all skin between the cornified and basal layers, as well as a variable thickness stratum lucidum. Treated surfaces will collect environmental dirt, "shed" top layers and are reactive to ultraviolet light by way of melanin production. If a treated surface becomes sunburned, the treatment will slough from its application site wholesale. Although treated surfaces function as skin, no thickness of application have yielded blood samples. Genetic testing has shown the treatment's biomass to be chimeric in nature, containing many different helix samples of a common Anglo-Saxon heritage. The source of SCP-1199's biochemical energy is yet unknown. Researcher's Note: During properties testing, a D-class supervised handler was chosen based on previous artistic inclination. D-1199-1 managed to create blisters, boils and calluses while applying the treatment to surfaces. When instructed to teach the skill to a researcher, D-1199-1 was able to train the researcher to achieve similar effects. D-1199-1 remained attached to the project for their term of service. Treatment may be removed from surfaces using industrial solvents or by scraping and peeling layers away from a treated area. Peeled layers maintain an elasticity similar to human skin and continue to sweat and generate heat for up to 24 hours. Stripped surfaces retain no anomalous traits save for a lingering sweat smell. Treatment remaining applied may regenerate, sweat and tan nigh-indefinitely. Application sample 1199-A is still healthy after 13 Feb 2012 13:52 as of this writing. Initial medical research has shown that the treatment does not graft to human skin, but dries onto it like paint. The treatment still retains its skin-like traits and forms a secondary epidermis not connected with a central nervous system. Research into medical applications as well as possible protections the treatment may offer against inclimate environments is ongoing. Liquid remains at a constant viscosity while in its can; research into possible anomalous properties of can -pending- on hold until conclusion of medical research. Addendum: Per O5-█: "This could be a boon to testing recoveries that have destructive effects to human physiology. Cross research with other SCPs is hereby permitted". « SCP-1198 \| SCP-1199 \| SCP-1200 » _ccartifactbiologicalchemicalectoentropicsafescp page revision: 31, last edited: 01 Oct 2022 11:12 Edit Rate (+157) Tags Discuss (34) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-120 rating: +608+–x Item #: SCP-120 Object Class: Safe Special Containment Procedures: Due to its importance to the Foundation, SCP-120 is to be kept under video surveillance and armed guard at all times. Any personnel attempting to utilize the item without authorisation are to be terminated immediately. All personnel wishing to use the item are required to submit a filled copy of the application form (Document #120-23) to facility operators. Due to the precise timing and coordination required for efficient use of this object in an emergency, all personnel entering SCP-120’s building are placed under temporary command of the facility heads Captain ████████ (Security Detachment) (L4) and Doctor █████████ (Research Team) (L4). All destination locations are to be kept under surveillance and armed guard. They are valuable to the Foundation but are non-critical, but any compromised destination must be immediately reported to SCP-120 personnel. Distributed Task Force Sigma-6 (“Puddlejumpers”) was created with the objective of protecting and maintaining SCP-120’s facility and location outposts. It consists of 1 command unit and 1 defense and maintenance unit based at the SCP-120 facility at Command-██; 5 units based at the destination locations, plus 5 reserve units for these; and 5 units assigned to other SCP-120 related projects. Description: SCP-120 appears to be a small child’s paddling pool, pastel pink in colouration, with an inner diameter of approximately 2.5 metres and inner height of 0.3 metres. The pool appears to have been fabricated from common Earth plastics but has shown itself to be indestructible by any attempted means (see research report #120-32 for a full summary). The pool’s structure and response to pressure are typical for such a pool (it will flex when pressure is applied and is soft to the touch) but has amazing tensile strength and cannot be permanently stretched or ripped. What is contained within the pool seems to be a brightly glowing, coloured, liquid-like substance, which seems to exist only partially in our dimension. It is unresponsive to manipulation by organic or inorganic means, but the substance ripples and shimmers systematically and regularly, suggesting it exists physically on another dimension. SCP-120’s most interesting and useful property is used regularly by Foundation personnel. Human beings, when alive and carrying loads (including clothing) under 37.8 kilograms, are observed to fall through the pool, and are deposited at one of 11 destinations. These will be detailed in an addendum. The item will only function in this way if certain conditions are met: the subject must be genetically human; the subject must be conscious; the subject must be carrying weights of under the specified amount; and only one subject must be present on the surface. Test subjects attempting to use SCP-120 while these conditions were not met reported their feet making contact with a smooth surface underneath the liquid but no significant effects were observed. SCP-120’s main use is as a potential means of evacuation for Command-██ during a major emergency. It is currently stored and maintained in a fortified outbuilding of this facility. To inspect evacuation procedures, refer to document #120-22. SCP-120 was first brought to the attention of Foundation authorities on 31/08/1992. Local police authorities in █████, California, were investigating reports of missing children in their jurisdiction, and discovered and reported the item on 31/08. Overwatch Command was automatically informed through the usual channels, and a small team of Foundation agents was dispatched to claim and transport the item to Site-19, where it remained for testing over the next 2 years. It was transferred to its present location at Command-██ in 1994. Addendum: Document #120-7: Destructive test results for SCP-120 – 24/12/1993 [Abridged version] Hand saw: 30cm – No result Industrial drill: Steel bit – No result Industrial drill: Diamond bit – No result Munition: 9x19mm Parabellum – No result Munition: 5.56x45mm NATO – No result Munition: 7.62x39mm – No result Munition: 120mm M830 HEAT – No result Cutting torch: Acetylene – No result Cutting torch: Hydrogen – No result Cutting torch: Propane – No result CO2 laser (peak power: 100 kW) – No result CO2 laser (peak power: 500 kW) – No result Document #120-10: Detailed explanation of SCP-120’s capabilities and destinations – 12/02/1994 [Abridged version] SCP-120 possesses the capability of instant translocation of human beings, possibly through one or more alternate dimensions. Subjects using the item are invariably deposited at one of 11 locations. These locations cycle in a specific and unchanging pattern. The 11 destinations and their locations were determined through testing with Class-D personnel carrying radio beacons. They are detailed here: Location 1: Pacific Ocean: SCP-120’s liquid displays a blue glow while connected to this destination. Subjects attempting travel to this destination are deposited an average of 2 metres above the surface of the Pacific at latitude █████████°S, longitude ██████████°W. A Foundation ship (SCPS Demeter – publicly the USS Nassau, a meteorological ship) is currently stationed at this location and personnel arriving through use of SCP-120 materialize inside the ship’s cargo hold. Sensitive Foundation material or personnel can be sent here in an emergency, and the ship has provisions for storage of low-threat SCP objects, should the need arise. Class- D personnel used to “dial” SCP-120 can be confined and extracted by helicopter or reused, or simply terminated and their bodies retained in storage. The original Class D and radio transmitter used to determine this location were lost at sea, and might have to be recovered in the interest of secrecy, if they were to wash up on populated shores. This configuration of SCP-120 was arbitrarily designated as #1, and has no observable significance above other configurations. Destinations 2 through 11 follow in sequential order after this configuration, and return to it after a full cycle. Travel by SCP-120 to this location is not advisable during storms due to risk of injury. Location 2: Greenland: SCP-120 displays a bright white glow while dialed to this destination. Subjects travelling to this destination materialize 1.5 metres above the surface of Greenland, at latitude █████████°N and longitude █████████°W. A small facility was established here, under the public pretense of oil industry expansion. This facility has similar capabilities and use to the Demeter, and is additionally equipped with an airstrip and refueling facilities. Location 3: L3: Located at the Earth-Moon Lagrange Point 3. The SCP displays a deep black colour. Objects and personnel sent through the SCP to any Lagrange point (locations 3, 5, 8, 10, and 11) are effectively lost, as retrieval is impossible at our current level of technology. They may prove a possible way to remove small but threatening SCP objects, but for now, are merely an inconvenience, as sacrifice of D-personnel is required to move the SCP to its next configuration. Location 4: Himalayas: SCP-120 displays a white glow similar to when it is dialed to Location 2. Materialization occurs at latitude █████████°N, longitude █████████°E, on a mountain in the Himalayan mountain range. Only minor changes have been made to the destination: the digging of an 8-metre hole for disposal of D-class bodies, an overhead canopy for concealment, and supplies and tenting for evacuation to this location (which should only take place in extreme circumstances). D-class personnel used for dialing are to be injected with a mixture of sedatives and neurotoxin before sending, to ensure a humane death and decrease risk of damage to the structures at Location 4. Location 5: L5: Identical to Location 3. Location 6: Sahara: SCP-120 will glow yellow. Personnel materialize at latitude █████████°N, longitude █████████°E in a small outpost. The need for secrecy renders this facility unable to house any significant SCP object, but is ideal for evacuation of personnel and documents from Command. Location 7: Gobi: SCP-120 displays a brown glow. This destination is located at a small outpost in the Gobi desert, latitude █████████°N, longitude ██████████°E, but is otherwise identical to the location 6 outpost. However, the expansion of SCP-4024 poses a significant threat to the outpost's operational viability. Location 8: L2: Identical to Location 3, although shows more potential for SCP disposal, being situated beyond the moon. Location 9: Mare Imbrium: The SCP displays a subdued grey glow when dialed in to this destination. This destination is on a relatively flat section of the Sea of Rains on the lunar surface. Through vast expenditure of money and D-class personnel, a small outpost has been established there, and is considered one of the Foundation’s safest locations. Location 10: L4: Identical to Location 3. Location 11: L1: Identical to Location 3. « SCP-119 \| SCP-120 \| SCP-121 » ‡ Licensing / Citation Cite this page as: "SCP-120" by Unknown author, from the SCP Wiki. Source: https:// scpwiki.com/scp-120. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxartifactindestructibleliquidportalsafescpteleportation page revision: 37, last edited: 01 Oct 2022 11:12 Edit Rate (+608) Tags Discuss (66) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1200 rating: +255+–x Item #: SCP-1200 Object Class: Safe Special Containment Procedures: Discovery and seizure of SCP-1200 are performed by FDA under CFR Title 21. Once in the possession of FDA, the recovered samples are to be replaced by non-anomalous duplicates and transferred to Site-197. As the SCP-1200-A entities do not require sustenance or oxygen, they are to be contained in individual reinforced containers and stored in the I-TL1 Wing of Site-197. Description: SCP-1200 designates all chewing gum distributed under the "Tastes Like Chewing Gum" brand. Packages of SCP-1200 periodically appear in various stores across the United States. The logo present on the packaging identifies the gum's manufacturer as "The Factory". When an SCP-1200 sample is masticated by a human subject, the sample's anomalous effects will manifest. The particulars and the duration of the effects vary based on the flavor of the sample. Currently, 83 flavors of SCP-1200 have been documented. Swallowing SCP-1200 samples does not produce any further anomalous effects. Addendum 1200-1: Partial list of SCP-1200 flavors. See 1200-E:KV for a full list. Designation Effects Label Color SCP-1200-12 Subject's gustatory perception was altered for 28 hours following the consumption of the sample. The subject was unable to discern the taste of consumed food, perceiving a lemon taste instead. "Tastes Like Lemons" Lime Green SCP-1200-15 Subject became luminescent, emitting over 40000 lux of white light. The subject was not harmed by the effect. The effect continued for 20 minutes, after which time its intensity gradually decreased, ceasing fully after an additional 4 minutes. “Tastes Like Sunshine” Bright yellow SCP-1200-29 For 216 minutes, subject was able to rearrange at will segments of her body, both internal and external. The functionality of the affected segments and the health of the subject was not diminished in the process. The alterations were accompanied by secondary changes in seemingly unrelated regions. Due to this, the subject was unable to return to her original body plan. "Tastes Like Rubik's Cube" Multicolored SCP-1200-30 Six corporeal humaniform entities manifested in the vicinity of the subject. The entities did not exhibit sapient behavior, instead mimicking the actions and speech of the subject, guards and researchers, and each other. The entities continued to exist for six days, before dissolving into a homogeneous liquid. Subsequent analysis of the liquid revealed it to be a mixture of organic materials, iron particles, and acrylic paint. "Tastes Like Those Forgotten" Dark blue SCP-1200-58 Polyhedral, crystalline exoskeleton formed around the subject. The resulting object proceeded to levitate at the height of 1.3 meters above the ground. The object remained inert for the next 62 days. After the conclusion of that period, the object broke apart, and the subject emerged unharmed. When debriefed regarding his experience, the subject stated that he was transported to a green meadow, where he met his younger brother. Notably, the subject does not have any living or deceased siblings. "Tastes Like Afterlife" White SCP-1200-62 Incorporeal, translucent, leporine organisms appeared to emerge from the walls of the subject's cell. The organisms proceeded to reach the subject and burrow inside her body. The subject did not react to these events and claimed to be unable to perceive the entities. Video recordings of the incident did not show any anomalous activity. The subject expired 11 days later due to exsanguination. No injuries have been found on the body. To date, this is the only known fatality caused by the effects of an SCP-1200 sample. "Tastes Like Moon's Shadow" Red Addendum 1200-2: On 2003-02-20, while conducting an unrelated investigation, Foundation operatives discovered a facility dedicated to production of SCP-1200-30. At the time of discovery, the facility was populated by 28 anomalous entities. The entities were subsequently contained, designated SCP-1200-A, and transported to Site-197. Instances of SCP-1200-A are animate humanoid entities composed primarily from wrought iron. SCP-1200-A have been covered in several layers of paint, typically white, dim blue, or yellow. The outer layers of paint are largely absent, while the remaining segments are faded and flaking; the underlaying material is showing signs of oxidation. In the center of SCP-1200-A's head is a large circular opening. No other features are present. When not contained, the SCP-1200-A entities will attempt to acquire recently deceased human bodies and transform them into SCP-1200-30. Each entity will locate a suitable cadaver and transport it to the base facility. There, the entity will regurgitate paint, various biological matter, and small slags of iron, into the mouth of the cadaver. The entity will repeat this process over the course of several weeks. Eventually, the body will liquefy, forming a dense homogeneous liquid, which will disappear via unknown means soon after. Chemical analysis of the liquid identifies it as the substance constituting 80% of SCP-1200-30 sample's contents. Addendum 1200-3: Cross-reference analysis of the Foundation Archives returned a relevant phone call. The call was made on 1999-06-02 from a pay phone located 2 km from the SCP-1200-A base facility. A single unidentified male voice can be heard on the recording. The transcript of the recording follows. Herrick, this is Davis. I'm all done with the psychopomps here. We redirected the output to the location you wanted, weren't any problems there. The goo should start arriving to you shortly. About your other order, Morton spotted some nanohives in Budapest. I'm heading out there tomorrow. They should do nicely for your task, after some tinkering. Make sure there won't be any issues with my payment this time. If your contacts at the Factory are unwilling, I can always find someone else. Call you in two weeks. Addendum 1200-4: On 2003-08-24, two days after dismantling of the SCP-1200-A base facility was concluded, packages containing a previously unknown flavor of SCP-1200 arrived to several non-clandestine Foundation facilities. The testing results are included below. SCP-1200-83 No anomalous effects observed. "Tastes Like Normalcy" Colorless « SCP-1199 \| SCP-1200 \| SCP-1201 » ‡ Licensing / Citation Cite this page as: "SCP-1200" by anqxyr, from the SCP Wiki. Source: https://scpwiki.com/ scp-1200. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxfactoryfeaturedfoodhumanoidsafesapientscptransfiguration page revision: 14, last edited: 21 Oct 2022 09:26 Edit Rate (+255) Tags Discuss (26) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1201 rating: +136+–x Item #: SCP-1201 Object Class: Euclid Special Containment Procedures: A 50 m perimeter around area 1201 is to be maintained at all times. Testing into the nature of SCP-1201-2 is to be done promptly and without hindrance to the route of SCP-1201-2 to prevent a possible containment breach of SCP-1201-3. Any change in behavior by SCP-1201-2 is to be immediately reported to the Site Director and the area is to be put on lock down. Changes in containment procedures are currently being drafted as of the incident outlined in Document 1201-C. Description: SCP-1201 is a shallow wall-fountain located in Damascus, Syria. The fountain itself displays no anomalous properties save for its use by SCP-1201-2. Although SCP-1201-2 appears to enter SCP-1201 during separate manifestations, entrance by Foundation personnel does not seem to be possible. An investigation is currently underway to confirm whether or not the placement of the well is purely coincidental. SCP-1201-2 appears to be a large, completely hairless chimpanzee similar in size to an average adult human male. Strength and agility exhibited by SCP-1201-2 is not considered to be abnormal relative to its size. The entity materializes within 40-48 meters of SCP-1201 each year on ██/██ at 23:23:46 with severe injuries including third degree burns, severed limbs, deformities consistent with exposure to triflic acid, and holes scattered around the body. SCP-1201-2 regenerates in the space of 12.3 seconds before attempting to return to SCP-1201. An outline of a typical occurrence can be found in Document 1201-A. Attempts to halt the progress of SCP-1201-2 toward SCP-1201 have been effectively unsuccessful, as the entity appears to assault researchers when coerced, and prolonged confinement of the entity seems to produce an adverse effect originating near SCP-1201. SCP-1201-2 is not hostile toward researchers during its manifestations but will actively attempt to remove or disable barriers between it and SCP-1201. SCP-1201-2 appears to be highly vulnerable to electrical shock but further attempts to halt the progress of SCP-1201 are not recommended due to events outlined in Document-1201-B. Document 1201-A: Events of ██/██/2002, Area 1201 Foreword: Fifth recorded incidence and observation of the manifestation of SCP-1201-2. The entity was questioned alongside researchers keeping pace with the movement of the entity on a pre-constructed motion track. The entity was visible for 20 seconds before disappearing into SCP-1201. SCP-1201-2 manifests 47 meters from SCP-1201. Subject appears heavily bruised around the torso and face, with third degree burns covering the body. SCP-1201-2 appears to regenerate to typical appearance in the space of 12.3 seconds before righting itself and sprinting toward SCP-1201. Agent Breen attempts communication. SCP-1201-2: The hell do you guys want? Agent Breen: What are you doing? SCP-1201-2: Going to meet Beth. Agent Breen: Who is Beth? SCP-1201-2: A real bitch. Agent Breen: What is Beth? SCP-1201-2: A bitch. Agent Breen: Thank you for your cooperation. SCP-1201-2 disappears into SCP-1201. END LOG Document 1201-B: Events of ██/██/1999, Area 1201 Foreword: Second recorded incidence and observation of the manifestation of SCP-1201-2. The entity was temporarily disabled with a prefabricated electric field after regenerating. The entity was incapacitated for 18 seconds before power to the grid was removed by Agent Sanders and SCP-1201-2 was released. Agent Sanders: You're going to want to cooperate with us. SCP-1201-2: The fuck is your problem? SCP-1201-2 attempts to break from the electrical current but is not successful. Agent Sanders: We're going to need some information before you go anywhere. SCP-1201-2: Not telling you shit. SCP-1201 begins shaking, and partially fractures from its foundation. A long, smooth, black mass with the appearance of a tongue, which will henceforth be referred to as SCP-1201-3, can be seen partially probing from SCP-1201. The tongue stretches in length over 40 meters toward Agent Sanders. Agent Sanders terminates the power to the containment on SCP-1201-2. SCP-1201-2 rights itself and collides with the appendage of SCP-1201-3, making contact and crashing into a wall. Flames begin to funnel out from the mouth of SCP-1201 and SCP-1201-2 is severely burned. SCP-1201-2 is pulled into the air by SCP-1201-3. SCP-1201-2: You bitch! SCP-1201-2 has the tip of the appendage in a headlock, 20 meters above ground. SCP-1201-2 begins tearing into the skin of the appendage with its teeth. SCP-1201-3 falls to the ground with SCP-1201-2. Flames begin to increase in volume from the mouth of SCP-1201. Temperature in the immediate area increases by 20 degrees Celsius. SCP-1201-2, still in possession of the end of SCP-1201-3, dives into the mouth of SCP-1201. END LOG Document 1201-C: Events of ██/██/2003, Area 1201 Foreword: Sixth recorded incidence and observation of the manifestation of SCP-1201-2. The entity was questioned alongside researchers keeping pace with the movement of the entity on a pre-constructed motion track. The entity was visible for 21 seconds before disappearing into SCP-1201. SCP-1201-2 manifests 49 meters from SCP-1201. Subject appears with a large hole in its torso. SCP-1201-2 appears to regenerate to typical appearance in the space of 12.3 seconds before righting itself and sprinting toward SCP-1201. Agent Breen attempts communication. SCP-1201-2: You guys are persistent. Agent Breen: Please tell us what you're doing. SCP-1201-2: Fine, fine. Since you're so fucking adamant about it. This has been going on for quite some time. Beth just doesn't know when to give up. I'm trying to teach it who the real king of Candy Land is. Agent Breen: You're being facetious? SCP-1201 jumps into the air, maintaining momentum while delivering a kick to Agent Breen's head. Agent Breen's head is severed and explodes on impact with a nearby wall. SCP-1201-2: You're ruining the fun. SCP-1201-2 disappears into SCP-1201. END LOG Document 1201-█: Events of ██/██/20██, Area 1201 « SCP-1200 \| SCP-1201 \| SCP-1202 » ‡ Licensing / Citation Cite this page as: "SCP-1201" by faminepulse, from the SCP Wiki. Source: https://scpwiki.com/ scp-1201. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxeuclidgamelocationprimatesapientscp page revision: 29, last edited: 21 Oct 2022 09:23 Edit Rate (+136) Tags Discuss (59) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1202 rating: +154+–x Item #: SCP-1202 Object Class: Euclid Special Containment Procedures: The subject exposed to SCP-1202 is to be quarantined from other site staff and personnel unless outfitted with clothing completely covering their entire body. A skin suit is equipped to the exposed subject after transfer of SCP-1202. The afflicted subject is to transfer ‘access’ to SCP-1202 to one other test subject before termination or death. It is recommended SCP-1202 be tested on D-Class already scheduled for termination. Description: SCP-1202 was recovered beneath a frozen lake near Site-█ in ███████, Canada. Personnel reported trouble sleeping and auditory hallucinations that often referenced the location of SCP-1202. A team was sent to investigate the lake based on the collective reports. A small wooden canoe was discovered in fragments on the lakebed next to an irregular ice formation. The chamber behind the blockage was empty save for the frozen and emaciated remains of the body of one human male, later DNA tested and carbon-dated, thusly identified as belonging to tribes once native to the lower portion of South America eight hundred years ago. The corpse itself has no interesting properties except the position of the body: one hand is fixed on the forehead and the other appears to be working a now absent object into its ear canal. Whether the cause of death is suicide or cold is unconfirmed. The agent who first made physical contact with the corpse began to hear a voice that did not cease until he had made contact with another human. The exposed D-class reported hearing the voice after grasping Agent █████’s hand and indefinitely afterwards. The exact mechanism that enables this transfer is unknown, as is the manner in which SCP-1202 communicates with the subjects. SCP-1202 will converse with the afflicted subjects, lecturing them about a variety of topics, notably theoretical physics, biology, and the classified study of [DATA EXPUNGED]. The psychological effect tends to be detrimental as the voice rarely ceases to 'talk' for periods any longer than twenty seconds. The current D-class responsible for bearing SCP-1202 requested to be euthanized at one week. The voice classified as SCP-1202 identifies itself as ████ ██████, a former researcher at Site-18. Whether or not SCP-1202 is Dr. ████ ██████ is still being debated, although inquiries expressed to test subjects ‘bearing’ SCP-1202 match archived profiles of the late researcher. Documentation: Transcription from Agent ████ Foreword: Agent ████ began hearing the voice while in the company of the coroner who was examining the body found in the cave. Agent ████ notified the Site Director. He was then tasked to record his initial conversation with SCP-1202. Hello? Can you hear me? I know you can hear me! Oh good. I’ve been expecting someone to come along, and here you are. You touched him didn’t you? My old friend? Yes, him. The one I had the falling out with ages ago. I was just having a conversation with him and then you came along. What? Him? The frozen one with the splinter in his head? Oh yes of course he’s dead, are you stupid? Stupid one he was too, my old friend. No offense to him but it’s true; love him to death, that stupid one. He thought he could run. He ran all the way here. The man crossed an entire continent to get away from me, ended up in a hole in the ice jamming a pick into his ear. I told him not to, again and again. Who am I? I’m [REDACTED]! Who am I? I’m responsible for [DATA EXPUNGED], the entire organization owes a great debt to me! Hmmm? Of course you’re interested. Yes I’ll tell you, but first I’d like to chat about things that we can both understand. Do you see that man in front of you? Yes the one with the beard. I’m going to need you to kill him for me. Yes I’m serious! How else will we get into headquarters undetected? He has the keycard, he has access to the [REDACTED], and once I get to it I can be done with all this mess. No? I should have figured you weren’t the type. Oh well. No don’t tell him you’re hearing things! What? You already did? Are you an idiot? How long have you been working here to be stupid enough to tell them you're hearing things? Ah. Well at least I know why you're recording what I'm saying. I figured you were just insane to begin with. That's a relief. You know, they’re going to throw you into one of those rooms now! They’ll have you drink that gelatin that perverted doctor isn't allowed to touch! Worse, they’ll keep me in here! I’m just far too interesting for them to get rid of. How? That is a good question, although you are too stupid to understand. Let’s say I was playing with strings and struck a wonderful note. Yes I’m referring to that, you dunce. You’re familiar with the concept. Sure. I bet you’re familiar with the theory of relativity too, familiar like I’m familiar with my strange uncle. I mean learned, my stupid friend, learned and familiar, like how I’m familiar with your brain. No, technically I’m not alive. Not in a biological sense. No. You wouldn’t understand. The Aztec man? I’m guessing roughly one thousand years ago. Yes, I failed miserably at poking sticks into space-time. What? No! I'm not going to explain, you wouldn't understand! No, I’m not going anywhere. We’ve hardly even met. How rude of you. Note: He's humming now. He won't stop humming. He's been humming loudly for several hours. « SCP-1201 \| SCP-1202 \| SCP-1203 » ‡ Licensing / Citation Cite this page as: "SCP-1202" by (user deleted), from the SCP Wiki. Source: https:// scpwiki.com/scp-1202. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxauditorycontagioneuclidhallucinationsapientscp page revision: 21, last edited: 20 Oct 2022 21:32 Edit Rate (+154) Tags Discuss (29) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1203 rating: +164+–x Item #: SCP-1203 Object Class: Euclid Special Containment Procedures: SCP-1203 is assigned to a 3m x 2m x 2m containment cell. The living space at Site-17 is outfitted with steel walls and one solid barred door that locks from the outside. There is to be one guard on duty at all times near the cell to ensure SCP-1203 does not attempt a self-termination or auto-abort. It is recommended the subject be dosed persistently with the prescribed anti-psychotic medicines and mild narcotics to avoid this possibility. These medicines will be replaced with restraints during SCP-1203's pregnancies. SCP-1203 is to be restrained at times when not under supervision. At no time is SCP-1203 allowed to leave Site-17. One to three hours before death SCP-1203 will begin seizing, followed by a state similar to catatonia, and ending in a cease of all bodily functions. Time of death is recorded after a pulse is shown in the newborn, rather than the mother’s natural death. Termination attempts on SCP-1203 as of the incident with Research Assistant █████ are indefinitely on hold. Reference Log from Failed Termination-1203b. Description: SCP-1203 is a human female, approximately 20 years of age, identifying by the name ‘Miranda’. SCP-1203 has been in containment for approximately 95 years, or 5 cycles as of SCP-1203's next natural death and birth. SCP-1203 was recovered from Xochicalco, Mexico. Agent ██████ began investigation with a lead based on local reports of disappearances near the Feathered Serpent pyramid (reference ██-████ in the ██████ newspaper, "La Policía Rescata a Bebé en Pirámide"). SCP-1203 was discovered near the pyramid summit accompanied by members of The Serpent's Hand. A 'mother' SCP-1203 could not be located. At 21 years of age SCP-1203 undergoes a process similar to parthenogenesis, resulting with the conception of one genetically identical human fetus. At an embryonic level this form of reproduction is comparable to the aforementioned medical phenomenon, however, new instances of SCP-1203 are not developmentally inhibited, and do not benefit from any (natural) extended longevity. SCP-1203 during any stage of her life has an identical biological profile to previous instances of SCP-1203. A definite date cannot be placed on the length of the existence of SCP-1203. The condition suffered by SCP-1203 is unique in that memories are also transferred from the mother to the newborn. Variances in the progeny of SCP-1203 are represented in the sense that SCP-1203 maintains memory of its previous lifespans. This experience of “rebirth” and the recollection of the event have a noticeable and detrimental psychological effect on SCP-1203. Based on these observations we can assume SCP-1203 is lucid in infancy and during birth. Addendum 1203-█: 12/23/1991 Documentation: Excerpt from Interview Translated Revision Dr. ███████: Tell us more about your family history. SCP-1203: I only remember back to my eighth grandmother, but only little bits and pieces. I recall other things but they’re kind of like a dream that you forget after you wake up. Dr. ███████: Tell us the experience you have after death. SCP-1203-: I fall asleep and I wake up. It’s dark and then I feel warm. I see a light like a tunnel, and I'm back again. Dr. ███████: How is the experience of being born traumatic? SCP-1203: I trust you do not mean the last time. I can still hear that poor man screaming. Dr. ███████: No. SCP-1203: I remember it. I'm there in both places, and I'm pushing myself out… It is unpleasant. Dr. ███████: Would you like the cycles to end? SCP-1203: Yes, and I would like to fly as well. Log from Failed Termination-1203b: Foreword: Due to lack of any discernible benefit to the Foundation and the current mental state of SCP-1203, a termination was scheduled on █/██/██ under supervision from the late Research Assistant █████. The attempt to abort cyclical rebirth of the subject took place shortly after SCP-1203s ‘first’ labor contractions. The decision to abort rather than terminate SCP-1203 was reached on basis that more could be learned in regard to the nature of SCP-1203 in this manner. Extraction was performed successfully, the newborn having been completely removed and separated from the mother. The mother was then pronounced dead. During the cranial potassium injection the mother as well as the newborn's (SCP-1203s) husk began to [DATA EXPUNGED]. What followed was a reportedly indiscernible eruption of viscera from Research Assistant █████. Both instances of SCP-1203 were found afterwards to be undamaged. The newborn recovered completely after the incident. No abnormal potassium levels were present. Research Assistant █████ was found afterwards completely drained of fluid, his circulatory system inverted and strewn from the mouth. The autopsy revealed no marks on Research Assistant █████ that would be indicative of a physical assault. No other anomalies were found save for extra hair growth of 300mm, a scar 1.067mm in diameter on the forehead, and an extreme case of hyperkalaemia. Related Sites: Site-17 Related Groups of Interest: Serpent's Hand « SCP-1202 \| SCP-1203 \| SCP-1204 » ‡ Licensing / Citation Cite this page as: "SCP-1203" by (user deleted), from the SCP Wiki. Source: https:// scpwiki.com/scp-1203. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxeuclidhumanoidloopsapientscpserpents-hand page revision: 33, last edited: 20 Oct 2022 21:32 Edit Rate (+164) Tags Discuss (26) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1204 rating: +39+–x Dr. Mayreder studying SCP-1204 Item #: SCP-1204 Object Class: Euclid Special Containment Procedures: Deceased specimens of SCP-1204 are stored within Site-77. As SCP-1204 does not survive in captivity or any other domestic environment, any instances identified in the wild are to be observed by mobile Foundation research teams and facilitated by Mobile Task Force Pi-1 "City Slickers". Ethics Committee guidelines suggest any SCP-1204 hosts should be euthanized after concluding relevant research. Monitoring of municipal government records has been discontinued due to its ineffectiveness in locating SCP-1204 specimens. Description: SCP-1204 is a human being which hosts a parasitic semi-corporeal being of unknown composition. CT scans of hosts reveal a tumor-like mass of varying size and location within the brain. Autopsies have shown the parasite to be invisible, detectable only through electrical pulses made upon contact. The spread of SCP-1204 occurs through oral contact between two humans. A contracting mass of pharynx tissue will elongate through the mouth of an infested subject and into the uninfected oral cavity. This process requires extended oral contact. What follows has not been studied thoroughly enough to conclusively document, but it is known that both subjects will be SCP-1204 carriers following contact. All known specimens of SCP-1204 have been transient or homeless persons, believed to have been suffering from various debilitating conditions prior to SCP-1204 infection. It is not known if this made them predisposed to infection or if it is more reflective of the general health of this population. The behavior and personality of SCP-1204 changes markedly after infection. They will become increasingly hypersocial, devoting significant amounts of time seeking out physical contact. SCP-1204 will experience "strong feelings of loneliness" as well as extreme idolization of one potential romantic partner. Sexual interaction occurs only incidentally. Physical symptoms of subjects with long-term SCP-1204 include persistent internal bleeding, memory alterations, and small but inevitable fatal tears near the rear of the nasal cavity and ventral portions of the brain. This suggests a tow on brain tissue during migration. Reasons behind the lethality of SCP-1204 are not yet known. Physical degradation does not correspond with the parasite's physical bodily interactions. Postmortem examinations reveal the absence of a hippocampus. Some evidence exists to show that SCP-1204 subjects may recall experiences and muscle memories of previous hosts, but this has not been confirmed. Once nearing expiration, SCP-1204 will cease seeking out further hosts for infection and will attempt to locate an uninhabited structure or region. Once alone SCP-1204 will typically find a small space to expire inside of, such as caves or crawl spaces. SCP-1204's remains rapidly decompose until skeletal. Scavengers will not feed on SCP-1204's remains.1 SCP-1204 was discovered after an unusual string of 'murder' and 'suicide' reports were uncovered by Foundation search algorithms reviewing local papers from portions of the lower southeastern United States, ranging from Palm Harbor, Florida to Clarksville, Tennessee. This linked string of incidents seems to have coincided over the course of 10 years and involved more than ███ individuals before SCP-1204 was detected by the Foundation and recovered. The origin of SCP-1204 has yet to be discovered due to a lack of public records regarding its victims. Addendum: Journal entry of SCP-1204-45, the only known first-person primary source detailing SCP-1204's effect on mental faculties. It is cataloged within Site-77's records as Document 1204-12. Original document was written on a variety of surfaces, including toilet tissue, strips of cardboard and bible pages. Good signs today on St. George. "Spaceship broken, need parts" was my favorite. But that was before I saw you when a sign came down and there was that face stubbled and dirty but handsome and stoic. Strong. Generous, gave out coffin nails like candy. I’ll just preface this by saying that I always felt like I could never be too close to you. I’ve felt that way for a while. I hope you’re at peace wherever you are now. It feels like you're so far away now… I don't know how I'm going to get through this… [IRRELEVANT MATERIAL REDACTED] Please don’t get angry at me for my friends. You say they're greedy but I might need a smellfungus tonight. It just hurts, it hurts so bad… I need someone to help ease the pain. Why did you have to die? I just feel like when we're hugging and stuff that I want to be closer, you know? Like I can't be any more close to you than possible. It's like, I don't know! Sorry I'm such a klazomaniac. It's such a weird feeling, like when we're lying down together like I just want to, I don't know, like, be you for just a second? Haha, hope that doesn't sound to creepy. ILY! Can't wait to smell you again. I jumped the first guy I saw at the camp. No kissing or anything. I'm really a piece of work aren't I Grace? Paul would hate me if he knew what I was doing. I'm just so fucking lonely. Maybe I'm trying to shake off Paul. I don't fucking know anymore. If I don't already have Cupid's itch I'm probably gonna get it soon. Come by my place later so we can talk, okay? How sweet are the sounds of lips pressed togeher bumping gums and grinders[sic]2 fuck you fuck you fuck you fuck you let me the fuck out you stupid pigs you want to keep the lips for yourself you stupid you jealous scunner thats why you have me locked in here because you.want.HIM.all.to.yourself. this is all part of your stupid plan dumb hole i didnt even care ill put you in a bone orchard convict me you just put me in here so you could have them throw my guts out. let me inside. i wants you. i don't want me i.dont.want.me, it says i can be with you. if i can get to you. we can both be with you. when i get to you SCP-1204-45 was not recovered for interview. Their journal entries were found by MTF- Pi-1 in an abandoned house during reconnaissance operations. DNA was lifted from the documents, although they have not been matched to any SCP-1204 remains to date. Footnotes 1. Foundation morticians are to use this detail to identify SCP-1204 in the field 2. Indentation which was erased by the writer « SCP-1203 \| SCP-1204 \| SCP-1205 » ‡ Licensing / Citation Cite this page as: "SCP-1204" by faminepulse, rewritten by Anonymous, from the SCP Wiki. Source: https://scpwiki.com/scp-1204. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. Source: Official United States Air Force Website License: Public domain Title: X-ray Vision Author: Staff Sgt. Julianne Showalter _ccbiologicalethics-committeeeuclidmind- affectingneurologicalparasiticrewritablerewritescp page revision: 18, last edited: 20 Jan 2022 06:03 Edit Rate (+39) Tags Discuss (12) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1205 rating: +154+–x SCP-1205 as of 7/██/██ Item #: SCP-1205 Object Class: Safe Special Containment Procedures: SCP-1205 should be kept in a windowless containment cell with low light, facing a surveillance camera. Air quality tests should be performed on a monthly basis, and the atmosphere adjusted to prevent mold formation. Personnel monitoring the live surveillance will be alerted by an alarm, in the event of any change in the object's size or shape; observation of the live video feed itself is discouraged, until more information on Incident 1205-G███ is available. Description: SCP-1205 appears to be a patch of decaying, floral-print wallpaper, still attached to a cut-away segment of wall. The paper appears to be aged and flaking, and seems as vulnerable to burning (both with fire and various chemicals) and cutting as comparable vinyl-free wallpapers. Subjects instructed to intentionally damage the item reported hearing a sustained shriek, as if from a far distance, reminiscent of the ascending pitch of tea kettle's whistle. Within twenty-four hours, any portions of paper destroyed will re-appear on the wall in their former location and in identical condition. Fragments removed by cutting or tearing inevitably crumble into a fine dust within minutes, reappearing after the same twenty-four hour period. The item has also been observed to change shape and size at irregular intervals. These changes have never added or subtracted more than six square centimeters from the object's approximate surface area. Under experiment conditions, interaction with the object has not been observed to produce any psychological, physical or other damages, short or long-term. However, controversy surrounding Incident 1205-G███ suggests that further testing for perception-altering influences is necessary. Incident Report 1205-G███ is required reading for all personnel assigned to SCP-1205. Note: The following file contains excerpts from Dr. E███ G███'s personal notes and logs. All references to Foundation staff and family members have been censored. Descriptions of events by Dr. G███ which have since been disputed by eyewitnesses are annotated accordingly. +Incident Report 1205-G███ Excerpts from the logs of Dr. E███ G███: 5/16 Guess someone believes in second chances; either that, or I haven't caught the punchline. New assignment, against all odds. Looks like wallpaper. E. can't stand the sight of it, but wished me luck. Started with measurements, today; nothing too interesting. One of the D's was sneezing and itching from the beginning— turned out he was allergic to the fabric of his new suit. His appearance changed more than the scp's. 5/17 Damage tests: it cuts, tears, and burns like paper. No unusual components in the ash or smoke; the fragments fell apart, though, which at least indicates that this isn't someone's idea of a hoax. E. isn't here today; off-site, somewhere in [REDACTED]. Sitting in the observation booth, where it's quiet. Must've been an hour or two, by now. Can't help wondering what that paper would have looked like, covering some old parlor wall. The red flowers look like poppies. The colors would have been striking, before the paper browned. Stupid thought. Maybe it never looked any different than it does now. Note: This is the first instance of the subject appearing preoccupied with the contained item; however, as other personnel have pointed out, the subject's remarks do not necessarily indicate fixation. 5/18 All of the portions removed and destroyed have grown back. The spots don't look newer, either— they show the same sign of age and decay as before. The D's seem fine; will have them clinically and psychological screened, to be sure. I don't like the sound of my own hypotheses, when it comes to what might happen next… (Really looked forward to telling E. He always calls on Sunday, if he can’t visit. Didn’t call today. Not yet. Why?) Note: Several pages following only detail the experiment procedures in shorthand. These notes match the official logs, and have been verified for accuracy by the assisting research staff. 5/27 Nothing. That's what happened next. No results. If I did something to make E. angry, he won't tell me. Saw him across the hall, yesterday. Smiled, and he smiled back. But he didn't cross over to talk to me, and he hasn't called since. Note: Once again, several pages of experiment procedure in shorthand, all pertaining to exposing D-Class to contact with the object. In place of the results recorded in official logs, the author has repeatedly written "NOTHING." in all caps. After this point, references to the Dr. G███'s continuing research are infrequent. 6/05 It isn’t just E. … dad hasn’t called in a month. No one’s called, in a month. I start to worry, then I hear from someone else that they’re doing fine. So why don’t they pick up, when I call? 6/06 Presenting myself for psychological evaluation, to be safe. I've stared at that damn wall long enough to memorize the pattern. 6/07 Shrink recommended anti-depressants. Feel like an ass. Note: It is unknown how Dr. G███ experienced the psychological consultation which did, in fact, take place. Dr. Rhys' report on their interactions verifies that he did recommend anti-depressants, and that the subject seemed melancholy and withdrawn, and fixated on the potential inconclusiveness of her research. … "Having worked in this business for some time, I did not find anything abnormal about these expressions of anxiety. However, I did recommend that she remove herself from physical and visual proximity of the research object." According to colleagues, Dr. G███ made no report of or attempt to follow this suggestion. 6/10 I’m getting as bad as E., when it comes to compulsions. Every night, seem to find myself sitting on the bed, back to the wall. Like it’ll collapse, otherwise. I shouldn’t joke about that, E., sorry. No one says hello, when we pass in the halls. And I can’t bring myself to say it first.. I’m not asking for attention. But they look right through me. Note: At this point, coworkers report that Dr. G███ took a hiatus from research work. She makes no record of submitting this as an official request. 6/12 They suspended my access to D-Class subjects, because of the lack of results. That must be what happened, because no one showed up— no one would explain why. No one seems especially worried about it…. couldn’t even find the shrink, for my appointment. Guess he forgot. I can’t really blame him… it's hard to notice every little thing. Sights and smells and noise in the background. Note: Neither of these statement correspond with other accounts; Dr. Rhys was in his office as scheduled, and alerted Dr. G███'s direct superiors when she missed the appointment. Dr. G███'s access to D-Class subjects was never suspended, and there is no record of an inquiry on the subject. 6/13 Didn’t leave my room today. Note: None of Dr. G███'s neighbors recall her going to or from her place of residence, on this or any following day. 6/15 I left my room today, walked around every floor. Every hallway. No one [written in pencil, too faint to be legible] They looked right through me. Note: Dr. G███ has been officially declared a missing person as of 6/18/██. Contrary to her written account, the last recorded interaction with Dr. G███ was 6/9/██. The reasons for her disappearance and its relationship to SCP-1205 remain a subject of debate. Dr. Rhys notes that Dr. G███ had no prior history of depression, and close acquaintances describe her as outgoing and articulate. The testimony of her [REDACTED BY REQUEST] corroborates these accounts, and highlighted numerous instances of the doctor's levelheadedness under duress both before and during her employment by the Foundation. Addendum 7/██/██: While performing air-quality tests in the containment cell, a junior researcher claimed to witness the following— "I'd just finished up… and I know it isn't a known issue, but I felt weird turning my back on it. So I backed out of the room, keeping an eye on it— and then I saw it move. It was like a little seam appeared in one corner, and a little scrap of it quivered, like someone was trying to tear it off. It pulled free and fluttered to the ground, but I must have blinked. When I looked again, it was gone." Addendum 2: An anonymous Foundation researcher notes that he/she has read both the incident report and Dr. G███’s original documents several times, and thoroughly. It is his/her opinion that sections of writing have since disappeared from the handwritten originals. This claim is disputed by other researchers. « SCP-1204 \| SCP-1205 \| SCP-1206 » _ccacousticartifactcognitohazardsafescpself-repairingvisual page revision: 33, last edited: 09 Jan 2021 00:54 Edit Rate (+154) Tags Discuss (43) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1206 rating: +293+–x Item #: SCP-1206 Object Class: Safe Special Containment Procedures: Foundation agents are to construct billboards advertising a Foundation-owned local restaurant chain in the event site of SCP-1206 near the town of ██████. Testing with subjects previously exposed to SCP-1206 has revealed that SCP-1206 cannot generate its effect if the view of the event site is impeded in any way. Description: SCP-1206 is a serendipitous phenomenon that is the convergence of three factors: the degree of sky visibility over the event site, if at the time the Green Line Track D outbound from Boston, MA passes said site coincides with dusk or "twilight", and whether or not passengers happen to be gazing at the scenery on the northern/right side of the train. Statistically, SCP-1206 has shown a preference for the times of 17:30 EST to 19:30 EST as summer dusk tends to produce more picturesque settings, as well as a degree of cloudiness that produces an aesthetically pleasing sky scape over the event site. Between stops [REDACTED] the Green Line train passes through an open 0.4 km long expanse of trees and shrubbery bordering the eastern boundaries of ██████ that classified as the Hot Zone. If the aforementioned conditions are met, passengers become intensely transfixed by the scenery for the entirety of the trip through the Hot Zone. Subjects have reported an overwhelming feeling of awe and the sublime, but have summarily failed to provide adequate descriptions of what they have seen. Researchers have speculated that subjects have been unable to describe SCP-1206 because it appeals to latent forms in the human mind that cannot be accurately defined by formalized language. As exposed subjects feel a compulsion to communicate their experience of the Hot Zone, individuals will invariably develop a language (hereby referred to as 1206-A) that will replace and eventually become the subject's preferred method of communication. 1206-A has developed concurrently even in isolated subjects. 1206-A apparently functions as a language of the subconscious, utilizing rudimentary language constructs intrinsic to the human brain that can communicate the emotional state and status of its speaker and listener flawlessly. It is to be expected that >75% of subject groups will eventually fracture, as it is impossible to lie or be subtle when speaking 1206-A. Written words bear a resemblance to [REDACTED], suggesting 1206-A is far older than the Foundation initially believed. Rough translations are possible, but the emotional sensations skilled speakers are able to convey far outweigh ordinary language constructs in lucidity of meaning, ease of use, and informational density. Non-speakers of 1206-A are still able to intuitively glean fragments of meaning from spoken instances, however complex. Only exposure to SCP-1206 has proven to trigger 1206-A. Should 1206-A become the de facto language of a nation or the world, its revelatory and reverent nature would cause total societal restructuring if not outright collapse. See notes by Dr. ███████ for summary of findings. + Addendum 1206-01 Addendum 1206-01: Agents monitoring travel boards were alerted to a possible second instance of SCP-1206 when Norwegian forums user ███ ████ wrote a lengthy post in 1206-A detailing his marital troubles following his discovery and adoption of 1206-A. Subjects were made to translate the statement into English. Transcript of relevant segment is as follows: "On 04/8, my family and I were walking across a bridge in [REDACTED]. An unassuming thing, not much to look at. The thing is though is that it afforded us the most beautiful view of the sunset a few weeks ago. I struggle to describe it even now. It felt old, primal, shining from out of time past. Like if I had a child's eyes, and everything sang with novelty. My daughter began speaking gibberish the day after. She was the first. I started the following Friday. Words poured out of me, ██████, ████, and █████████.1 The wife was next. For many days, we reveled in the power of it, in capturing the flight of a bird or the growl of the car engine in a word. But it was exhausting. You could not lie in this language. Case in point: my wife left me the following month. I had noticed her word for me made her uncomfortable. It dug up something in her, all the bad qualities about me she had never liked but had buried under the habits and routine of marriage. My stubbornness, my insistence on having a son, how I came home one Friday night reeking of perfume. All in a word. I have visited that bridge every dusk for the past two weeks. Sometimes it is ordinary, sometimes it glows with an old fire. I know there are more places like that bridge. I can feel them. The last vestige of the beauty that gave us God and the courts of spirits, nerve-ends shuddering awake with life. Our society has no words for them, and you can't sing of them because they are where songs come from. I think when humanity was young, we must have been like children, unnaturally wise in all the subtle things of the earth. We spoke the names of majesty everything called themselves. Now that is all gone, but it is still there to discover. It huddles in the blind spots of our modernity, in the blankness of maps. If we can only see it, only feel it atop our rationalist perches, our aviaries angular with number and category, swaying in the winds of death. Melt into the blood of love! Find me! The bridge is in [REDACTED]." Agents apprehended ███ ████ for questioning. Study into the ███████ Bridge as another Hot Zone for the SCP-1206 phenomenon is ongoing. + Summary of 1206-A findings by Dr. ███████ Even the student linguist will see that there is something wholly unique about SCP-1206- A. For one, 1206-A has words for the exact appearance or 'impression' of an object/ person. For example, speakers of 1206-A would go beyond describing the parts or attributes of a person's face, but actually call every face a unique word. 1206-A does not rely on its listener forming an incomplete picture from a description of compositional parts, but has a near-infinite base of words used to encapsulate and describe a wide variety of objects including faces, bodies, the character of a person, the appearance of the sky on any given day, the weather, how a particular conversation made the speaker feel, or even a mound of dirt. Many of these words might be similar, derived from each other, or differ in syllabic emphasis to signify related categories of appearance, personality, feeling, abstract concepts etc. For example, after a particularly grueling session recording over ████ words with D-17368, the subject described the interview as leaving him feeling "██████", a heteronym of "██████" and roughly analogous to "drained", but with added emphasis on the ██ syllable to signify the nature of what caused the subject's fatigue as intensely bureaucratic and procedural. The name for the Hot Zone is "█████████" and is the only word that does not share similarities with any other. As is the nature of 1206-A's flexible nomenclature, subjects will often create words on the spot. There are no rules regarding the formation of words. Once a functional set of 1206-A words has entered the speaker's lexicon after Hot Zone exposure, subjects only report needing to meditate momentarily on the object of their description before inventing a word that "fits like a glove". Other speakers will immediately accept the word as the name for that object. Studies with isolated subjects asked to describe the upturned contents of the break room trash receptacle has yielded the same word - █████ - suggesting a universality in the method of word invention that is intrinsic to the brain's physiological makeup. Studies are ongoing. — Dr. ███████ Footnotes 1. Only recorded derivation of the word used to refer to SCP-1206. « SCP-1205 \| SCP-1206 \| SCP-1207 » ‡ Licensing / Citation Cite this page as: "SCP-1206" by bbaztek, from the SCP Wiki. Source: https://scpwiki.com/ scp-1206. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxlanguagelocationmind-affectingsafescpvisual page revision: 31, last edited: 21 Oct 2022 08:06 Edit Rate (+293) Tags Discuss (61) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1207 rating: +312+–x Item #: SCP-1207 Object Class: Safe Special Containment Procedures: SCP-1207 is to be wrapped in opaque cloth, and contained within a standard inanimate-objects locker. In accordance with standard protocol for direct-exposure line-of-sight cognitohazards, SCP-1207 is to be kept under constant real-time video surveillance whenever it is removed from its locker for any purpose (maintenance, analysis, experimentation, etc.). Direct exposure to SCP-1207 is to be minimized. Maximum cumulative direct exposure for individual personnel is not to exceed 2 (two) hours within a 30 (thirty)-day period, or 24 (twenty-four) hours within an individual lifetime. Personnel whose cumulative direct exposure to SCP-1207 exceeds 2 (two) hours within a 30 (thirty)-day period are to be immediately placed on psychological leave until such time as they have been judged free of the symptoms of body dysmorphic disorder, and are not to resume active duty until they have successfully undergone retraining in data entry and proofreading. Description: SCP-1207 is a miror approximately one meter by one half meter in size, in a white wooden frame painted with pink and red hearts. Using the Kinscale method of miror-type object evaluation, Foundation scientists have established it as a minor level psychological threat. SCP-1207 is a metal sign approximately fifty centimeters by sixty centimeters in size, painted white, with embossed letters reading "THIS IS A MIROR YOU ARE A TYPO" (sic). It is a direct-exposure cognitohazard, which manifests three distinct anomalous effects upon subjects within line of sight. The first effect, which is the most obvious, is that any sighted person mammal vertebrate directly exposed to SCP-1207 will perceive it as being a mirror, even if they are aware of its true nature; test subjects not capable of mirror recognition will perform territorial threat displays against SCP-1207. Human subjects uniformly describe the mirror as being contained within a white wooden frame with "pink and red hearts"; however, more detailed descriptions vary from subject to subject. Blindfolded subjects report that SCP-1207 feels "smooth and glassy", with "wood around the edges"; conversely, blind subjects report that SCP-1207 feels "metallic and bumpy". It is to be emphasized that, despite the perceptions and reactions of affected subjects, SCP-1207 does not actually function as a mirror. The second anomalous effect is that subjects exposed to SCP-1207 will rapidly develop symptoms of body dysmorphic disorder as they examine their "reflections". Human subjects will voice a variety of complaints about their physical appearance, ranging from "I'm the wrong height" to "my tattoo is crooked", and always ending with "I'm not cool yet"; nonhuman subjects capable of mirror recognition will perform compulsive grooming. As cumulative exposure time to SCP-1207 increases, subjects will begin to modify their appearances in attempts to "correct" themselves, typically by application of cosmetics; subjects without access to cosmetics will engage in self-mutilation. Such subjects, when shown actual mirrors, will express satisfaction with their modifications; however, when re-exposed to SCP-1207, subjects will again find fault with their appearance. The third anomalous effect is that subjects exposed to SCP-1207 will gradually develop symptoms of dyslexia, losing their ability to spell, and to notice spelling errors; this effect is limited to subjects familiar with the English language, and always begins with the subject consistently misspelling the word "mirror" as "miror". The induced dyslexia is temporary; however, the factors determining the rate at which individual subjects recover have not yet been determined. SCP-1207 was discovered in an abandoned storage unit facility in [REDACTED], which had been in use as a workspace by members of the group of interest currently identified as "Are We Cool Yet?". It is theorized that SCP-1207 was to form the basis of an unfinished installation. Notes left by the artist indicate that the completed installation was "a rumination on the essence of how the ways we see ourselves shape what we are". « SCP-1206 \| SCP-1207 \| SCP-1208 » are-we-cool-yetartifactcognitohazardmind-affectingrewritesafescpvisual page revision: 15, last edited: 29 Jul 2021 00:30 Edit Rate (+312) Tags Discuss (130) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1208 rating: +177+–x Item #: SCP-1208 Object Class: Safe Special Containment Procedures: SCP-1208 is to be kept in secure item storage at Site-19. Researchers wishing to perform experiments with SCP-1208 using human or animal subjects must present a detailed test plan to the Lead Researcher for approval. Description: SCP-1208 is a "Belgian" waffle iron, identical in every outward respect to a unit produced by the Conair Corporation in 2003, except that its power cable is fitted with a NEMA 14-30 connector rather the grounded NEMA 5-20 connector provided with that model. When connected to a compatible 240V receptacle, the PTFE-coated cast- iron cooking surface rapidly warms to a surface temperature of 215 C, at which point the green indicator light on the front of the device illuminates. At this point, SCP-1208 may be used to prepare waffles using any standard batter without anomalous effect. The anomalous behavior of SCP-1208 occurs when it has reached operating temperature and any solid material other than a batter or dough is placed between the two heating plates and the lid is closed. Regardless of the material so placed, applying torque of approximately 1.3 N·m to the handle of the device will successfully close the lid, displacing any material in excess of the volume of the cooking area (approximately 1400 cc) to the outer edge of the device. At this point, the red indicator lamp on the front of the device will illuminate, and the device will not open until three minutes have elapsed. (Forces of up to 106 N have proven insufficient to open the lid during this phase.) Copious amounts of steam are emitted from between the two plates during this process. After three minutes, the red indicator lamp will darken, and the lid may be opened with minimal effort. Both cooking plates will be cool to the touch (approximately 15 C), and a "waffle" composed of the matter placed between the plates will be present. Deformation caused by this process is entirely topological: any substructures present in the source material remain intact but deformed. Incomplete sections of plant or animal tissue will remain alive for a short period of time, normally succumbing to necrosis due to lack of fluid circulation within 60 minutes. Animals small enough to fit completely within the volume of the cooking area may survive slightly longer, though feeding and respiratory difficulties due to their new body plan typically prove fatal in 1-3 days. « SCP-1207 \| SCP-1208 \| SCP-1209 » ‡ Licensing / Citation Cite this page as: "SCP-1208" by murphy_slaw, from the SCP Wiki. Source: https:// scpwiki.com/scp-1208. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxapplianceelectricalsafescptransfiguration page revision: 14, last edited: 20 Apr 2022 15:04 Edit Rate (+177) Tags Discuss (68) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1209 rating: +114+–x Item #: SCP-1209 Object Class: Euclid Special Containment Procedures: SCP-1209-1 instances are to be contained in standard humanoid containment cells at Site-██. They are to be fed meals three times a day. SCP-1209-1 instances are to be allowed to submit requests for entertainment or comfort materials which do not compromise security, within reason, as a reward for good behaviour. Socialisation with assigned Foundation staff is allowed, and encouraged in order to improve psychological well-being, but instances are not allowed to come into contact with each other. SCP-1209-1 instances are to be questioned at regular intervals by Foundation staff, and their responses are to be recorded, in order to document any noteworthy events observed and further understanding of SCP-1209. These interviews are to be conducted twice daily, at approximately 0800 hours and again at 1900 hours, as well as any time at which an SCP-1209-1 instance requests such an interview. SCP-1209-1 instances which have observed potentially traumatising events are to be monitored by an assigned psychiatrist, but may not be administered amnestics. It is considered vital that SCP-1209-1 instances retain their memory of transmitted images in case this knowledge becomes pertinent at a later date. SCP-1209-2 instances are largely passive and do not present anomalous behaviour aside from connection to SCP-1209. As such, no containment procedures are required to directly deal with SCP-1209-2 instances aside from monitoring. However, efforts should be made to identify all SCP-1209-2 instances. Should any SCP-1209-1 instance observe an event which is considered pertinent to the Foundation's mission, the Site Administrator of Site-██ is to be notified immediately in order to discuss responses. Description: SCP-1209 is a congenital defect of the eye found in several individuals from the region of [DATA EXPUNGED], and believed to be caused by an environmental factor. As a result of the deformity, the eye’s internal structure is drastically altered, although the most noticeable feature of the condition is the presence of multiple irises, pupils, lenses and associated anatomical features on the surface of the eye. Number of lenses per sclera is typically between two and four. This condition is usually accompanied by complete heterochromia, where each iris is differently coloured. As a result of the presence of multiple corneas and a distortion of the sclera, sufferers report mild to severe discomfort when attempting to move their eyes, and some have only limited range of movement in one or both eyes. In many cases, deformities in the internal structure of the eye render one or more of the lenses partially or totally blind. An in-depth analysis of the abnormal optical structures found in SCP-1209 subjects can be found in attached document 1209-α. Individuals affected by SCP-1209 (henceforth referred to as SCP-1209-1) appear to be able to see normally through only one of the pupils, usually the one aligned closest to where the pupil would normally be located. All other pupils display a view of the world consistent with that seen through the eyes of other individuals (henceforth referred to as SCP-1209-2). Each pupil displays images as seen by a single, separate person, and the persons that each pupil is able to ‘see through’ appear constant at all times. Each SCP-1209-1 instance is connected to multiple instances of SCP-1209-2, as many as there are additional pupils. These connections allow SCP-1209-1 to experience visual stimuli only, and appear to only transmit through the left eye of SCP-1209-2 instances. SCP-1209-1 cannot perceive SCP-1209-2’s experiences when they close their eyes, or when their eye is damaged beyond the point at which SCP-1209-2 can see through them. Should SCP-1209-2 die, transmission of images will continue until the internal structure of the eye deteriorates to a significant degree due to decomposition. If SCP-1209-2 is permanently blinded, or if the SCP-1209-1’s additional pupils are damaged significantly, transmission of images will cease. However, defects in the additional pupils do not prevent transmission; only injury or trauma prevents transmission. SCP-1209-1 will continue to perceive the experiences of SCP-1209-2 while dreaming, although reported transmission is less complete than while awake. There appears to be a distinct correlation between SCP-1209-1 and SCP-1209-2, in that all SCP-1209-2 instances were born within approximately two hours of the relevant SCP-1209-1 instance’s birth. SCP-1209 was discovered following routine scanning of medical files at ███████ Hospital. Subsequent investigation led to the discovery of █ SCP-1209-1 instances born in the nearby area, centred on the town of ███████, and more specifically the main water supply of the town. Investigation revealed the possibility that an unknown chemical had been introduced to the water supply repeatedly over the previous ██ years by an unknown party, posing as maintenance workers in order to access the water supply network. Although this event is believed to have had some connection to the outbreak of SCP-1209 due to a correlation between periods of ‘maintenance work’ and conceptions resulting in SCP-1209-1 instances, it is presently impossible to determine whether the two incidents are related. All remainders of the compound believed to have been introduced into the supply had degraded into other chemicals before testing could be performed. No experimentation has been able to determine the exact cause of SCP-1209. Addendum 1209-1: List of noteworthy SCP-1209-2 subjects (a full list of identified SCP-1209-2 subjects can be found in Document 1209-β): ████ █████, Aide to ██████ █████, Secretary of State of [REDACTED]. Linked to SCP-1209-1-3. Considered noteworthy due to the considerable intelligence breach SCP-1209-2’s existence represents. As a result of Foundation intervention, Mr. █████ has since been removed from any position of political power. ███████ ████, a noted criminal operating as part of the central African militant group [REDACTED]. Linked to SCP-1209-1-2. Killed in combat action ██/██/ ████ Due to the graphic and distressing nature of transmissions from Mr. ████, SCP-1209-1-2 was been placed under psychiatric observation, and remains so despite Mr. ████'s death and the cessation of transmission. ███████ ███████, an Australian journalist working for ██████ █████ newspaper. Linked to SCP-1209-1-1. Killed ██/██/████ during an investigation involving material sensitive to Foundation interest, during which she witnessed the outbreak of the cognitohazard later classified SCP-████, though SCP-1209-1-1 was not affected. Remains to date the only use of SCP-1209 in order to assist • • • Foundation efforts, as questioning of SCP-1209-1-1 was vital to providing intelligence allowing for the capture of the instance of SCP-████. Unknown individual linked to SCP-1209-1-3. Shortly after SCP-1209-1-3 came into Foundation custody, this instance of SCP-1209-2 is believed to have blinded himself in order to avoid detection. Prior to loss of transmission, the individual wrote down the message ‘I DON’T CARE FOR PRYING EYES. LEAVE ME ALONE’, apparently with the intention of transmitting the message to SCP-1209-1-3. It is unknown how or to what extent the individual was aware of his connection to SCP-1209. Unknown individual linked to SCP-1209-1-4. Careful analysis of data received from SCP-1209-1-4 indicates that no such individual was present, or could have been present, at some of the events described by SCP-1209-1-4. However, all descriptions of events relayed through SCP-1209-1-4 have proven to be accurate save for the appearance of the observing figure. Several events observed by this individual are extremely important or sensitive, although no transmission has been reported since ██/██/████. « SCP-1208 \| SCP-1209 \| SCP-1210 » ‡ Licensing / Citation Cite this page as: "SCP-1209" by Rioghail, from the SCP Wiki. Source: https://scpwiki.com/ scp-1209. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxeuclidgenetichumanoidsapientscpsensoryvisual page revision: 19, last edited: 21 Oct 2022 08:04 Edit Rate (+114) Tags Discuss (25) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. • • Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-121 rating: +318+–x Item #: SCP-121 Object Class: Euclid Special Containment Procedures: Containment Site-83 has been established outside SCP-121 to house personnel dedicated to the containment of SCP-121. The perimeter of SCP-121 is to remain fenced off from the surrounding area, with guards stationed along the perimeter at all times. Guards are to don local military uniforms and remain heavily armed at all times. Rotation of guards is to occur every four hours. The surrounding population is to remain informed that SCP-121 is quarantined due to persisting hazardous material. Warning signs are to be placed seventy-five (75), fifty (50), and twenty-five (25) kilometers out along roads leading to SCP-121 to deter trespassers. Civilians who approach the perimeter of SCP-121 are to be reminded of the quarantine and forced to depart; those who resist are to be detained for questioning. In the event that approaching civilians witness an active instance of SCP-121-1 or -2, Class-A amnestics are to be administered. Any meteorological data regarding SCP-121's anomalous effect is to be censored, and SCP-121 has been labeled a no-flight zone to prevent knowledge of SCP-121, -1, and -2. Site Task Force Iota-71 ("Home Wreckers") has been established and permanently assigned to Containment Site-83 in response to the threat of SCP-121-2. They are to escort researchers interested in studying non-hostile instances of SCP-121-2 as well as neutralize any instances that have grown to potentially lethal sizes. In the event of an attempted containment breach, Iota-71 is to assist perimeter guards in the neutralization of the instance of SCP-121-2. Any buildings within SCP-121 that develop into SCP-121-1 are to be recorded and monitored at all times for transition into SCP-121-2. Instances of SCP-121-2 that become innately hostile upon transition are to be neutralized; however, passive instances may continue to dwell within the perimeter of SCP-121 for research purposes until they've grown to a size too dangerous to contain or become hostile, at which point they are to be neutralized. Description: SCP-121 is the region of land occupied by the former town of ███████, Colorado. The town was home to roughly 6,800 prior to enactment of current containment protocol, and holds roughly 3,000 buildings, both residential and commercial. Clouds above SCP-121 appear incapable of entering an area roughly twelve (12) kilometers in diameter, instead passing around the area; it is speculated this is related to SCP-121's range of effect, but it is not known how at this time. Buildings in SCP-121 will sporadically1 detach from any foundations and ascend into the air. At this point, these buildings are identified as SCP-121-1. Instances of SCP-121-1 ascend to a random height of a minimum of forty-five (45) meters. Regardless of the previous state of the building, doors and windows become locked and any potential entry ways become barricaded by furniture inside. Forced entry has shown an increased ambient temperature of roughly 35°C and a relative humidity of roughly 65%, but a lack of any further anomalous properties. Instances of SCP-121-1 will cease suspension after a minimum period of ten weeks, but may remain airborne for no more than fifteen weeks afterwards. Instances do not show any abnormal levels of durability, and near-total destruction of SCP-121-1 upon impact with the ground is common. After impact, the remains of instances of SCP-121-1 will contain an ovoid object approximately 1.2m x 1.2m x 2m composed of materials consistent with furniture found inside the home.2 The object will begin to locomote on its own accord; at this point, it will be referred to as SCP-121-2. SCP-121-2 begin to form a conglomerate with nearby materials, including debris from SCP-121-1, flora, automobiles, and (on rare occasion) other buildings. SCP-121-2 will continue to attract objects until it forms a body of material nine (9) meters in height, at which point the body will animate and appear to take on levels of sentience. SCP-121-2 may, at this point, begin to simulate ingesting other material, to continue growing at a considerably slower rate. Ingestion appears to be for the sole purpose of continued growth, as instances have gone prolonged periods of time without material. Certain items have been known to attach to SCP-121-2 instantaneously, despite size and the lack of simulated ingestion. Instances of SCP-121-2 normally resemble animals capable of locomotion on land, but have been known to take on humanoid forms and forms that do not resemble any known animal. They are primarily docile, and normally do not display hostility towards personnel unless provoked. However, SCP-121-2 instances have been known to form with innate aggressive and territorial behavior; this behavior has also been observed to develop following the accumulation of certain items, including firearms, bladed weapons, and in one example, the taxidermy head of a bear. SCP-121 came to the attention of the Foundation when local authorities were flooded with reports of a previously abandoned residence suddenly "flying in the sky". The town was evacuated under the guise of a hazardous material spill and the residence was observed. Once the instance of SCP-121-1 transitioned into SCP-121-2, SCP-121-2 was quickly neutralized. Following the neutralization, another instance of SCP-121-1 developed3, and the town was permanently evacuated and contained. Incident 121-A: On 11/04/98, a sound described as a "muffled siren" was heard for approximately five (5) minutes. An active instance of SCP-121-1 was suddenly subject to an immense force following the sound, causing the building to prematurely break apart while suspended before the ten week minimum. Neighboring towns reported hearing the sound; local press were informed quarantine staff were being evacuated due to a temporary elevation in toxic levels. The cause of the sound is currently unknown; further research is recommended. Three weeks following the sound and the destruction of SCP-121-1, the remains finally fell to the ground. Inside the rubble were remnants of the ovoid object found in SCP-121-2, along with traces of aluminum slag. Incident 121-B: On 05/09/12, a 1991 Dodge Caravan was found suspended fifty-three (53) meters in the air. Internal surveillance is at this time impossible, due to the windows being obscured by what appears to be wool cloth. Further observation of the vehicle is recommended. Footnotes 1. No more than one at a time, with three weeks minimum between manifestation. 2. Examination of mostly intact instances of SCP-121-1 show an absence of previous furnishings. 3. This is the only occasion on which the creation of SCP-121-1 has so closely followed the creation of an instance of SCP-121-2 « SCP-120 \| SCP-121 \| SCP-122 » ‡ Licensing / Citation Cite this page as: "SCP-121" by Wilt, from the SCP Wiki. Source: https://scpwiki.com/scp-121. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxairbornecityeuclidmetamorphicmeteorologicalscp page revision: 33, last edited: 02 Oct 2022 07:17 Edit Rate (+318) Tags Discuss (59) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1210 rating: +66+–x A secondary bunker located near SCP-1210-2 Item #: SCP-1210 Object Class: Euclid Special Containment Procedures: A Foundation laboratory ship as well as two patrol ships are stationed in the region surrounding SCP-1210 at a range of no less than 10 km. As SCP-1210-2 remains active, expeditions to or experimentation with SCP-1210 for more than five (5) hours after a recorded emission event may only be performed with prior permission from at least two (2) Level 4 Personnel. Infrared and visible-light photography by the next over-passing surveillance satellite must be scheduled immediately after a recorded emission event. The area surrounding SCP-1210 in a radius of 15 km is marked as off-limits on all official maps, and radar overwatch is to be maintained using unmanned aerial vehicles (UAVs). Civilians attempting to approach SCP-1210 must be detained and questioned. Description: SCP-1210-1 is an uncharted island approximately 31 km off the coast of [REDACTED], Russia with an area of 3.4 km². Its unusual shape suggests that it may have once been larger, but that the eastern half of the island was 'sheared off' via unknown means, leaving a sharp delineation at which point several buildings and roads as well as utility lines have been cut off. SCP-1210-2 is a World War II era radar installation located on the main hill of SCP-1210-1, consisting of a large radar array and a control bunker containing its readout equipment. Cyrillic signage indicate that the site is named [REDACTED], but no official documentation of this site exists in any Russian or Soviet-era records. The site is in an advanced state of disrepair consistent with multiple decades of abandonment, though several rooms are remarkably well-preserved due to having been inside sealed bunkers. Forensic examination of the site indicates that site personnel were forced to abandon the area in haste and head towards the eastern end of the island, where the main power plant and living quarters are presumed to have been located. Despite having been disconnected from an active power source for at least 50 years, SCP-1210-2 is still active and periodically generates a low-powered, anomalous radar pulse emission that radiates out to a range of approximately 9 km. The period and frequency of these emissions is unstable, but are usually at or about ██ ms and ██ to ██ Hz. These emissions are also irregular, and have been recorded repeating as often as once every six (6) hours, and as rarely as once every seven (7) days. During each emission event, localized shifts in the area surrounding SCP-1210-2 occur that coincide with the propagation of the emission signal. These include but are not limited to: changes in the topography of the sea bed and ocean floor, changes in the local plant and animal life, as well as short-lived changes in the chemistry and organic content of the water surrounding SCP-1210. Prior to current containment procedures, individuals within the Red Zone of SCP-1210 during an emission event reported being able to feel a 'ripple' pass through their bodies, resulting in short-term nausea as well as tingling in the extremities that persisted for several days. In rare cases, subjects have also reported short-term memory loss and fatigue, and in two (2) cases, personnel were discovered missing and were unable to be located. Incident Log 1210-1: On ██/█/██, an emission event occurred while two (2) research personnel were in open water on a small power boat. Foundation patrol ship SCPS Treska received a panicked distress signal that was shortly cut off. Upon investigation, the Treska discovered the shredded hull of the power boat, with puncture damage consistent with the teeth from a C. megalodon. Additional Foundation assets are being considered to deal with the possibility of extinct or otherwise anomalous wildlife as a result of SCP-1210's emission events. « SCP-1209 \| SCP-1210 \| SCP-1211 » _cceuclidextradimensionalislandlocationscptemporal page revision: 14, last edited: 31 Jul 2023 17:52 Edit Rate (+66) Tags Discuss (26) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1211 rating: +48+–x SCP-1211 Item #: SCP-1211 Object Class: Euclid Special Containment Procedures: A perimeter of 50 meters is to be maintained around SCP-1211 at all times. Any civilians approaching this perimeter are to be redirected away from the site with fabricated reports of danger in and around the structure. No male personnel over the age of 35 are to be allowed to enter the premises under any circumstances. Description: SCP-1211 is the dilapidated ruin of a castle, 10 kilometers outside the city of ██████, Ireland. Only the first floor and basement of the structure remain in functional condition, the upper three floors having eroded and collapsed at indeterminate points in the castle's past. Initially, it was thought that any person entering SCP-1211 would be subject to its effect, though testing has proven that only males age 35 and older are affected. The reason for this is thought to be related to the terms of eligibility for kingship in Ireland at the time of the castle's construction. Within minutes of entering SCP-1211, any male at least 35 years old (See the Testing Log for correlation between the effect of SCP-1211 and Irish descent) will be immediately convinced that he is the rightful heir to an imagined throne, owner of the castle, and "lord of all lands as far as the eye can see,"1 refusing to leave the premises, even under threat of lethal force. The cause of these delusions is unclear, though the effect appears to be much more pronounced in individuals of Irish descent. Subjects of exclusively Irish lineage may even attempt to subjugate any personnel in their vicinity; these attempts have occasionally resulted in fatalities and should be treated as serious assaults on Foundation staff. If left on-site for extended periods, affected subjects will begin to live more and more in a fantasy where they are a king during a time of war, pacing the interior hallways of SCP-1211 and whispering to themselves in the Irish language, even in cases where the subject had no knowledge of Irish before coming into contact with SCP-1211. Translations of such speech have proven it to be mostly threats of violence against imagined “rival clans” and imagined scenarios of what the subject would do should any man challenge his right to be king. If left on-site for long enough, subjects will begin to age rapidly. After three weeks of exposure to the castle's effect, a man of 35 years will have visibly aged to approximately 80 years. Physical deterioration is difficult to measure after this point, as it continues to accelerate at a different rate for each subject. After one month, some subjects are observed to experience rotting of the skin, muscle tissue, and general deterioration of the skeletal structure; others can take multiple months to reach this point. At no time has any subject expressed need of food, water, or sleep during this process, and no subject has ever died of old age while affected by SCP-1211. A subject that has deteriorated to such an extent that he can no longer pace the halls of SCP-1211 will invariably make for its basement and collapse there, still alive, at which point the walls will begin to build themselves around the subject. Any murmuring observed after this point will consist only of the Irish word for "happy" again and again. All subjects cease to vocalize at all soon after this event. Addendum 1211-001: Dr. Davidson's research team has noted a 10% increase in surface area in the remaining portion of the second floor. Weekly measurements are to be taken as testing continues on SCP-1211 and any further changes are to be reported immediately. + Show Testing Log Test A - 05/26/19██ Subject: D-1355, 36 years of age, native to █████, Ireland Procedure: Subject is equipped with a handheld transceiver and camera with a live feed to the research team's base of operations. Subject is instructed to enter and explore the ruins. Audiovisual Log: View is of a long, dark hallway. Few details are discernible. D-1355: Fuck, it's creepy in here. Dr. Davidson: We're not getting as much as we should be on the video feed. Try to focus the lens. Subject can be heard fiddling with buttons on the camera. D-1355: Is that better? Dr. Davidson: We're making a note of the unusual darkness. Continue on. A large hall becomes visible. Much of the ceiling is missing, yet the video feed remains too dark to discern much detail. Dr. Davidson: D-1355, what do you see? We're still not getting much on the feed. D-1355: It's so beautiful… or it used to be, at least… Dr. Davidson: What is it? Report what you see immediately. Subject does not reply for slightly over one minute. D-1355: Murmuring Dr. Davidson: Speak up, son. What do you see in there? D-1355: It's mine… Dr. Davidson: What? What's yours? D-1355: It's all mine… They'll never get it… Dr. Davidson: You aren't making any sense. Explain yourself at once or we'll terminate you and get somebody else. D-1355 remains unresponsive, muttering to himself. The camera is abruptly dropped. The camera continues to record for 3 subsequent hours, during which time D-1355 slowly wanders in and out of the hall. At the 2 hour mark, a scream is heard from outside the hall in a language that none of the researchers speak. The last hour of footage is similar to the first 2 hours. Research note: SCP-1211 seems to somehow alter the mindset of those who enter it. I'm requesting permission to experiment further. -Dr. Davidson Footnotes 1. Note that subjects in all cases have used exactly these words. « SCP-1210 \| SCP-1211 \| SCP-1212 » _ccbuildingeuclidmemory-affectingmind-affectingscptemporal page revision: 17, last edited: 06 Jun 2017 09:52 Edit Rate (+48) Tags Discuss (27) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1212 rating: +193+–x Item #: SCP-1212 Object Class: Safe Special Containment Procedures: SCP-1212 is kept in a 5m x 5m x 3m containment cell at Site-██. Experimentation may only be performed with prior permission from at least two (2) Level 3 personnel, and the room is to be cleared of any residual body fluids or other detritus immediately after testing. Any instances of SCP-1212 discovered within SCP-3311 are to be immediately be moved to Site-██ for long term storage. Description: SCP-1212, while not in use, is a simple wooden bar stool with a height of 74 cm and seat dimensions of 38 x 38 cm. It does not possess any abnormal physical qualities other than a faint odor of alcohol, and there are no maker's marks or other identifying features present. When any living, mentally sound human being older than fifteen (15) years of age sits on SCP-1212, two occurrences of abnormal activity can be immediately observed: SCP-1212, while leaving the occupant unaffected, changes shape almost instantaneously; ███ separate iterations have been observed (with none repeating), including: a shiny metallic bar stool with bright red plastic seat a crude wooden stool which appeared to have been painted very poorly with black paint a smooth sandstone chair elegantly carved with unfamiliar square symbols which have as yet been unable to be conclusively identified a low, square stool engraved with cloud motifs believed to resemble those manufactured in the late Chinese Qing Dynasty The occupant appears to experience a full sensory hallucination and is no longer able to sense what is occurring around them in reality, while being completely unable to be removed from SCP-1212 (even using extreme methods; see Addendum 1212-A). The occupant of SCP-1212 is then heard speaking to someone, but all attempts to record the other half of the conversation have so far failed. Usually, it becomes apparent that the occupant (hereafter referred to as 'the contestant') has been invited to participate in a drinking contest, and the contest begins regardless of acceptance or refusal of the invitation. All surviving subjects agree that the invitation includes two phrases similar in content to, "You must drink with me, in memory of those who sat where you sit and lacked the strength to understand their limits," and "We must curse those who were weak, and honor those who were strong." Sometimes, the contestant is spoken to in a language they do not understand, attempts made to bridge the communication barrier fail, and events proceed as normal. The contestant then, willingly or forcibly, appears to mime the following actions in sequence: taking a container of liquid from a surface in front of them; placing it to their lips; drinking its contents in one • ◦ ◦ ◦ ◦ • smooth motion; then slamming the container back down onto the surface. There is always a period of between thirty (30) and fifty (50) seconds between each sequence, presumably as the contestant waits his or her 'turn'. The contestant is always capable of speech, but is always interrupted by the drinking action - no interference of any kind appears to be possible. Despite no actual liquid passing between the contestant's lips, they slowly begin to exhibit effects normally associated with alcohol intoxication, and as each sequence continues, the effects of intoxication become more and more severe. Nausea, slurring of speech and drooping of the eyelids and other facial features are usually the first in evidence, followed by bodily swaying, choking and vomiting. None of the mentioned effects appear to prevent the contestant from participating further - some contestants have even appeared to cease vomiting for the exact amount of the time it takes to take another drink, before resuming said oral expulsion of liquids. Subsequent testing of these liquids and the bloodstream of the contestants has revealed no alcoholic substances were ever present. The 'drinking' continues even after the contestant is seen to visibly suffer the effects of severe alcohol poisoning, usually typified by unconsciousness, limpness of body and occasional shuddering. Posture is still maintained, with no interruption to the miming actions. The contest will only end when one of two conditions are met: A period of time elapses that is no less than one (1) hour in length, with an average of one (1) drink per minute; of the ███ tests undertaken by the Foundation, only ██ contestants survived long enough to reach this point, and 95% of that group were unconscious (see Document 1212-B12). SCP-1212 then reverts to its normal shape, and will no longer react to the presence of the contestant. Alcohol poisoning causes all bodily functions to shut down, resulting in death. Upon cessation of heartbeat, the contestant is released from SCP-1212 and falls to the floor. SCP-1212 then returns to its dormant shape and size. Addendum 1212-A - Interruption It has been proven physically impossible to interrupt the contest once it has begun; this includes outside termination of the contestant by any means. Any wounds sustained that are not part of SCP-1212's effect are simply ignored, fatal or otherwise; notably, in the case of Test 1212-0██, the contestant appeared to continue miming the actions of drinking with both arms severed neatly just below the shoulder - the cut was visible, but there was no evidence of bleeding, pain or lack of function. When the contest ended and the contestant released from its effect, both appendages immediately fell off, causing extreme pain and cardiac arrest resulting in death. Addendum 1212-B - Test 1212-0█1 Subject: D-392010; male, Caucasian, 21 years Test Supervisors: Dr. T██████, Dr. S███ Date: ██/██/20██ Dr. S███: Sit down on the stool, D-class, and then describe what you see. You won't be able to hear us, but we will certainly hear you. • • (D-392010 slowly sits down on the stool. Almost immediately, the stool lowers by nearly half a meter and transforms into a bar stool made of shiny metal and plastic. D-392010 becomes visibly shaken.) D-392010: What the.. uh, is this supposed to happen? I'm in some sort of.. dive bar, I dunno, some guy across from me is looking at me funny and there's a crowd here, I don't- (D-392010 appears to survey his surroundings, mouth agape, and then tilts his head as if listening to someone.) D-392010: You want to what? Drink me under the table? You wish, buddy! (D-392010 breaks out into a huge grin, and laughs.) This is gonna be one hell of a test, I can tell. You're on. [REDACTED] Dr. T██████: Ten minutes in.. looks like he's holding up well, but he can barely speak.. I don't think he's realized yet. (D-392010 is swaying back and forth, grinning manically while consuming each invisible drink.) D-392010: W-whoa, buddy, you just d-don't sstop, do you.. Do you think we c-can take a break of a few mininutes or something? No? To hell with you, p- pal, I'll stop wwhen I want t-.. Hey.. (D-392010 begins to struggle, but his arm appears to move by its own accord, forcing him to take another drink.) D-392010: The fuck is happ-(gulps down a drink) hhappening to me.. the fuck is this, I don't.. Somebody, pplease stop this, I don't want to keep going, you've won, buddy.. W-what the fuck do you mean, "The contest is underway"? Hey, hey, doc! Gget me out of here! T-this is just a freaky illusion or something, right? Get me-(chokes, but keeps drinking) Augh, this sshit is foul.. (D-392010 continues threatening Foundation personnel and attempts resisting the test, but cannot stop 'drinking'. He begins gibbering irrationally, flailing his head side to side, back and forth when not compelled to take another shot. After several minutes, he begins vomiting a light brown mixture of lumpy liquid.) D-392010: (screaming) GOD, MAKE IT STOP, YOU WIN, YOU WIN, FFUC- (vomits, pauses to take a drink, then resumes vomiting) [REDACTED] (D-392010 is unconscious and jerking back and forth involuntarily. His jumpsuit pants are soaked from the waist down, the floor under the stool now covered with various substances. He continues to mime drinking.) [REDACTED] (An unconscious, visibly reddened D-392010 feebly jerks back and forth several times, before pausing in the act of mid-drink. Slowly, he keels over and falls off the stool, landing in a now large puddle of bodily fluid.) Dr. S███: Time of expiration, fifty-two minutes, forty-seven seconds. (D-392010 twitches once more, before ceasing to move altogether. SCP-1212 reverts to its normal state, no traces of fluid on its wooden surface evident.) « SCP-1211 \| SCP-1212 \| SCP-1213 » ‡ Licensing / Citation Cite this page as: "SCP-1212" by Esperion, from the SCP Wiki. Source: https://scpwiki.com/ scp-1212. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxartifactgamehallucinationmetamorphicmind-affectingsafescptoxic page revision: 22, last edited: 21 Oct 2022 08:07 Edit Rate (+193) Tags Discuss (39) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1213 rating: +162+–x Item #: SCP-1213 Object Class: Safe Special Containment Procedures: SCP-1213 is to be strapped immobile in a locked shipping container, stored in Sector-25. SCP-1213 is not to be allowed within 20 meters of juvenile mammals weighing between 15 and 50 kilograms, except for testing purposes. Description: SCP-1213 is a wooden and steel catapult, medieval in design, 1.4 meters wide and 2.6 meters long. SCP-1213 is capable of autonomous locomotion on its four wooden wheels and of operating its firing mechanism by an unknown method. Aside from its anomalous movement and operation SCP-1213 has no unusual physical properties. Given space to move, SCP-1213 will haphazardly explore an area. Should SCP-1213 encounter a suitable subject, SCP-1213 will transport the subject into the basket on its firing arm by unknown means. SCP-1213 must be within 10 meters of its subject in order to transport it. SCP-1213 will then launch the subject at the nearest flat vertical surface. After a launching it will remain stationary, emitting a sound similar to the contented purring produced by felines while it resets its firing arm. SCP-1213 will then resume its haphazard exploration. SCP-1213's firing arm can be strapped down, but any strapping will break should SCP-1213 launch a subject. SCP-1213 favors infant to prepubescent mammalian subjects that weigh between 15 and 50 kilograms. SCP-1213 has also been known to launch subjects with dwarfism on occasion. SCP-1213 was found in █████, a farming town in England, after several unexplainable cases of dead children and small animals that were reported as having been "hurled into walls at high velocity". A search of the town found SCP-1213 in the bushes of a school playground. Further investigation of the town led to the discovery of an improvised laboratory in an abandoned farmhouse. Much of the laboratory was destroyed by an explosion, presumably caused by the large defunct device that was the focus of the laboratory. The device was the experimental work of Dr. ████████, who could not be located. Dr. ████████'s damaged research log was discovered in pieces amongst the debris of the warehouse, and only excerpts could be retrieved. Excerpts of Dr. ████████'s research log: Pieces of text that were missing, burnt or otherwise illegible are marked with […] I've done it. I've finished. I've pressed the button. I flipped the switch. I've changed the world forever. Even as I sit here it opens […] […] the noise is unbearable, I can see objects moving beyond […] Any dimension. EVERY dimension. I can see won[…] If only I could interact […] access […] perhaps I […] This […] particular is fascinating to me […] impossible, but […] I can't deny […] There are families of them, unbelievable, all different types […] what we would believe to […] inanimate […] different 'species' […] The tire-irons seem particularly amiable, […] […] somehow t[…] whatever i did, it worked […] but it's here now, in this […] I think it's separated from its 'parents' […] I've grown fond of it, it […] no family of my […] so long […] alone working […] Its abandonment here […] grown an animosity […] can't keep it […] […]uck! I can't s[…] I've […] should reduce massive dam[…] town is safe […] but I can't find Hurley any[…] found Su[…] splatt[…] Robert like a tomato […], oh my god. « SCP-1212 \| SCP-1213 \| SCP-1214 » ‡ Licensing / Citation Cite this page as: "SCP-1213" by SwamplessThing, from the SCP Wiki. Source: https:// scpwiki.com/scp-1213. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxautonomousmechanicalpredatorysafescpteleportationweapon page revision: 38, last edited: 21 Oct 2022 08:20 Edit Rate (+162) Tags Discuss (52) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1214 rating: +221+–x SCP-1214 during Phase 2 Item #: SCP-1214 Object Class: Safe Special Containment Procedures: The laptop computer containing SCP-1214 (designated 1214-L1), and all its peripherals are to be kept in a standard laptop case in a secure locker in the Computer Science Department of Site-33. No testing is to be performed on SCP-1214 without the authorization of the Senior CSD Administrator, Dr G. Wilson. As per Standard Anomalous Computer Equipment Regulation 4324-B, 1214-L1 must under no circumstances be connected to a network of any kind. Description: 1214-L1 is a standard Dell XPS Ultrabook laptop computer including power supply and mouse. Software installed includes the Microsoft Windows 7 operating system and Microsoft Visual Studio 2012. Several coding projects can be found in the "Documents" folder of user █████. Most of these are programming exercises in the C# programming language. SCP-1214 is a project, also written in C#, with the name "random_number_test". The program consists of approximately 60 lines of code. The program generates random numbers in the range 48-90, which are then interpreted as ASCII character codes. This gives the possibility of generating the characters in Table 1, below. Table 1, possible characters generated by SCP-1214 algorithm 0-9, A-Z (alphanumeric, upper case) colon (:) semicolon (;) less-than(<) equals (=) greater-than (>) question mark (?) at sign (@) The characters are assembled into lines of 50 characters each. One (1) such line is printed to a text window every second while the program is running. + Sample of program output, time elapsed < 1 minute QGZ33I=9F@?AQQGPK6SGN?NLW;=JMP>GWBM=S5FIMPRXFE=9RO DSL?RAT>7R<MGP1RD?49XEK:TYGQ5BY4SY<EVGJ;DEYN<Z92VN 0Y5IRZ8BFTU38OT7UICGWXOSOBFXXTODUABZZ:6==C1QAA=9T4 5JJ?R2:<T?C:DL4@8Q=U8KB69DVXA>5<3SO5UFJ?PM@QU2Z@M0 8FWZWE7C6=7<VE:67KXZEM6Y4F:L<6DF;@5J@3W:XA@<7CQUGN V>CMEF?XU@:F7ZTL0E@KP3NN24=UQLO?5H;63IUI:B9GZA9@CF C;EVXRJPKA9E79LUAJONHBKQ@=U7NKUWA:9CU9JCF>XC?P;ZV5 0JKPX0KNFKWC10G<4W0807Z;7:E7AK2V<IK:;K<8R6NZG3<XV3 L>ZM4SJ@HMFD=UH16C?=0CJR@TD0O4YH;>ZNVJDRJV2IM>TSAE WSHI28N7=;>JKCOY8YVU5GZGM5@1410LJ:85ZM<QZN<8D0;JUO 6VWF?@T0WWSM3;;MZA;IYFL5UB:Q3LUQ6?V5O3UR<YP?Y<K1XQ 1T>;QJ9QLX52X:21GN@6YWFC=ZP=7HQ9S=K0BVI<VXBXM91E=W The anomalous properties of SCP-1214 can be hard to detect at first. However, running the program output through a stochastic analyzer will show that while the output begins by following the expected pseudo-random distribution used by modern computers, this will gradually change the longer the program is allowed to run. Eventually patterns with an unexpectedly low probability will begin to emerge. + Sample of program output, time elapsed ██ minutes 7T?RYA?M5JXAAAAPO?FATQU=LQL<9OQYBTA7?7@Q:TA?A13AAJ 2IAAHIAGBDAH@:A@A4AAKAQAK5ZNAT:RAQBI7ACAYHDYYTP6AW 2A5W@AXA4ANAAAX=ACJR?>AAATAAAAAXXAUW3AO>AMDAAG<X5A AHM8?<9AAHOADJ?A=;3AA67AAAMNO<A<;VAFYAA:2;1AAGJA2A AWRAA1WP76A5A:S=JA99DOAA39A;?YAS1J@YAQMNI3A0JA>N<S N5AAU=3J=AAAAGLLAAJRA4A>AQ51AARQLA>NAAH:AKAUDY<?QK BAA4AA9;A9AAAS2ABAPH;FAX2XAJK;SMI4FGW022ASAVAAABAA =PD?>AAG?6ZEZAFAA?AA7PSAVNAF@A?AAA:DAV;3AA:Y2><:AA A8LKD2AI;AAIAEAWACAN@AZ8E19A0IAIPHAT61U8>FGMH8AWCI ML?A;PAQA>AG8AVUAGANZYAAQNGAAAFDUAAASV@:>AGB0OFORY <PKARZ6=FD?AQ5?APAAAR59AA7DVFDAAA1IURAAA?2AXAU2AAA In this example, a clear bias towards the character 'A' can be observed, not consistent with the expected random distribution that SCP-1214's algorithm should generate. Approximately ██ hours, ██ minutes after program start, what appears to be semi- coherent sentences start appearing in the output. This point in time is designated "T". Periods before and after T are designated Phase 1 and Phase 2, respectively. + Sample of program output, time elapsed ██ hours, ██ minut ACCCCCCCCCCCCCCRROL8L7=3ZA0E7L@7FJP0LY4Q2IBR5NBSYA Y90KI:68PAU0CU:>ARXD5SKMAKEEY;Z8FPIT7V0EUD9NV26HHR =JUE<6I5EEFK9DBMEM737FQBJLIWZ3X7X7Y?STOPI1@EZ::P<9 GC@DJRTBFFFFFFFFFFFFFFAAAAAAAAAAAAAAAAAASTOP0WVYXL G8:9T3:O0ELHZF8M1QQQQQQQQQQQQQQQQQQQQQQB:2C1MAKEK= VF3U4>MUAPV4C;E:8NZKCCITSEPDUIGON=LN3CLDGONFM?X0QZ NNVL:;2K2JI8ITU17QQGBQG:B>WXPCGSTOPSS13ALBA2V?OJKK 86:9HW7KOOOOOOOOOOOOOOOOOOOOO3J<=4;AED>XL7R81HHRZ1 TIAJC1CT>HOOOOOOLLLLLLLLLLLLLLLLLLLLLLLLLL5PAZVJWY QQC=MSR59PLEASEX7YX;8445OMV2TA6OH?GK68KA9OD:FY65ID RWMLQLL>I0XP;R;PLEASEY>G1CJUNOGPC@I91VHUYRJKCCCLZG H0L3LTHMOREROSC7<V91WPLEASEN3IZXV18F4@NPKV<:S72R7< 7HCXJ3C3FMEU31?4WNJX2W7C@18=P@XGGQBADXA421T1;QS:UN Example of words found in output during Phase 2 (underlining added). Identified words in this example: "MAKE", "IT", "STOP", "STOP", "MAKE", "IT", "STOP", "PLEASE", "PLEASE", "NO", "MORE", "PLEASE" At ██ +/- 3 hours after start of Phase 2, the frequency of identifiable words starts to drop. At the same time bias towards long strings of the same character starts to slowly increase. Additionally, the number of different characters in the output begins to diminish, as if the probability of them appearing has dramatically decreased. This is designated Phase 3. + Sample of program output, time elapsed ███ hours, ██ minu I690KGZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZRT@1W 6;5@?R@82DT54UJX6WM8E=UK2IQ4TG7:=XIGTRJZ>;VG?ITND@ 9PSEN6XXXXXXXXXXXXXXXXXXXXXXXXXX4T4KI@KIJRRWE4G6QI QJ?W6DH;6ZH0G:PX7BIR@DHBUB<JRRRRRRRRRRRRRRRRRRRRR@ 56QE<1;<G8328G7BDZ1XT>KD8:3>7C2Z:84G4VB68IQ;XQMR?8 ==========================================<30=?B5W :95EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEV87SSD W90:=QR=BD33PUICVQ@PMK5S?CZTE1UG8RZKG5C7433R:08=9T HNUN1>ZCXR299MJXWV6TJ:C00000000000000000000000000X DBKPM:JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ71P ?M5?75TID688TSM<XTS556PIIIIIIIIIIIIIIIIIIIIIIIIVQ7 W9HIH4413VU9G<MUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUH@ ER::::::::::::::::::::::::::::::::::::::::GD;1@345 E6G>TGW6T7XISWUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUCPU IN=XXTZWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWR3E:T;J Example of output during Phase 3, Test Run 14. Probability for characters A, F, L, O and Y has dropped to 0, or near 0. They do not appear in the output again during 1214-TR14. Phase 3 continues as described with no further variances. The longest test to date has been 1214-TR27, where SCP-1214 was run for ██ days, and showed a ██ percent reduction in the character set during Phase 3. Stopping and restarting the SCP-1214 program results in a repetition of phases 1 through 3, with slight variations in program output as well as the lengths of the respective phases. The current theory is that the diminishing probabilities observed during Phase 3 will continue until only one (1) character remains in the output. Calculations show that such a result would require the program to run for somewhere between ███ and ███ days. Additional: After the occurrence described in Addendum 1214-3, SCSDA G. Wilson ordered testing of SCP-1214 to be suspended until further notice. Addendum 1214-1: Standard Electronic Contamination Tests (SECT) have proved negative. SCP-1214 does not appear to be able to infect other computers, and copies of the SCP-1214 program will not exhibit anomalous properties. Addendum 1214-2, acquisition log: 1214-L1 was retrieved by Agent █████ from the campus dorm of ██████ ████ University, after a persistent rumor had circulated among the students that there existed an experimental program that "behaved funny" if executed over a period of several days. The rumors were exaggerated and ranged from speculations about "rogue government AIs" to "impossible patterns seen in 'The Game of Life'". Fortunately, the owner of 1214-L1 appears to have shunned the attention this was generating, and exposure was therefore kept to a minimum. After acquiring the item, Agent █████ deployed a Class-IV Worm in the university network to monitor data traffic for further indications of SCP-1214, or similar activity. So far none has been detected. Addendum 1214-3: + Incident report, ██-██-████ ██-██-████, Test Lab 1214-2. Test Run 28 was started, with the goal of letting SCP-1214 run for double the length of 1214-TR27. Standard video capture / OCR scanner setup used to record SCP-1214 output. Personnel assigned to 1214-TR28 was Lead Researcher, Dr H██████, and Research Assistant, Dr P█████. Phase 1 completed according to expectations. However, at ███ minutes into Phase 2, the following words, quite different from the Phase 2 data acquired up to this point, appeared in SCP-1214's output: 0?C9HWIHURTSHURTS9?PLEASE STOP=::::::::::::::::::: ::::::::::SIGNAL::TRACE::COMPLETE::WE::RESPOND::IN ::KIND:::::::::::::::::::::::::::DWW30PLEASEPLEASE Approximately five (5) seconds after this point in time, Dr H██████ appeared to be caught by a seizure lasting for 13 seconds. She then fell unconscious and dropped to the floor. After a period of 17 seconds, Dr P█████ followed the Emergency Protocol and hit the cutoff switch, terminating all power to Test Lab 1214-2. (Dr P█████ later received a reprimand for failure to react within prescribed time limit.) Dr H██████ was brought to Emergency Medical Facility ███, where her condition was monitored and found to be stable. She revived after 34 hours, at which point further examination revealed that she had undergone a uniform 23% loss of visual, auditory, tactile and gustatory acuity. Olfactory acuity was unaffected. (See Reports 1214-345 through 1214-347 for speculation on this discrepancy.) Dr H██████ remains under medical supervision until further notice. « SCP-1213 \| SCP-1214 \| SCP-1215 » _cccognitohazardcomputersafesapientscpvisual page revision: 19, last edited: 02 Oct 2022 07:20 Edit Rate (+221) Tags Discuss (63) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1215 rating: +82+–x SCP-1215 in containment; the object's effects are not transferable through photographs. Item #: SCP-1215 Object Class: Euclid Special Containment Procedures: SCP-1215 must be contained within a locked room pursuant standard Level 2 (Moderate Threat), Type 3 (Visual Stimuli), Mind-Altering Protocols. Access requires written approval. Due to the object's age and fragile nature, SCP-1215 must be maintained in a hermetically-sealed chamber of inert gas with extremely low humidity at a temperature of ten degrees Celsius. SCP-1215 should not be exposed to ultraviolet light for longer than absolutely necessary. Routine inspection, and maintenance as necessary, is to be performed twice monthly by religious Class-D personnel certified in the care of rare books and manuscripts (cooperation of these Class-D personnel is grounds for indefinite suspension of their termination). Failure to comply with these measures will result in the object's significant damage and/or destruction. Personnel exposed to SCP-1215 are to be placed in isolation for their own protection and the protection of other personnel. A sincere confession and repentance of one's sins to a qualified priest of the affected personnel's religion, even for religious traditions which do not include a confessional rite, has been shown to cause the effects of SCP-1215 to subside over the following 24-48 hours. For non-religious personnel, confessions to individuals holding doctorates in philosophy have proven effective in approximately 60% of cases. Personnel who cry while confessing generally recover more quickly and (if non-religious) have higher likelihoods of recovery. Non-Class-D personnel who are asymptomatic after fourteen days may resume their previous duties after the successful completion of a psychiatric examination. Description: SCP-1215 is a 4th century illuminated manuscript, written in Medieval Greek on vellum. It was recovered from an archeological dig of a Byzantine monastery in ███████████, Turkey. Illustrations are decorated with both gold and silver. The manuscript is a version of the Peri Logismon, apparently an original copy written by the work’s author, Evagrius "The Solitary" Ponticus (345-399 CE), a Christian monk and ascetic. The Peri Logismon is a treatise on temptation, and the “Eight Evil Thoughts”, the predecessor to the more modern “Seven Deadly Sins”. The text of SCP-1215 varies appreciably from other copies of the work. Individuals exposed to the text or illustrations within SCP-1215 have their behavior altered, though these alterations do not appear to manifest themselves until the individual leaves the immediate proximity of the object. Subjects exhibit behavior consistent with one of the “eight evil thoughts” described within the manuscript. Analysis of personnel and D-class under SCP-1215’s influence suggests that the alterations to their behavior are based on their prior personality; additional testing for a statistically significant sample is ongoing. The effects of SCP-1215 vary, not only based on which vice manifests itself in the behavior of exposed personnel, but also in the severity of the behavior. Currently, symptoms are divided into three phases. Phase I (Initial) symptoms are exhibited immediately upon leaving the vicinity of SCP-1215, and are sufficiently minor that they may go unnoticed. Phase II (Intermediate) symptoms are exhibited starting approximately 12-36 hours of leaving the object’s vicinity, and, while noticeable and potentially hazardous, are unlikely to result in permanent harm to the subject or others. Phase III (Terminal) symptoms are exhibited starting after approximately 48-96 hours of leaving the object’s vicinity. Phase III symptoms often result in significant harm to the subject and personnel nearby. Observed effects of SCP-1215 are as follows, though no subjects exposed to SCP-1215 have been known to exhibit more than one of these effects: Gastrimargia (Gluttony) – The subject develops an intense and insatiable appetite. Phase I symptoms are minor feelings of hunger or thirst, consistent with not having eaten for several hours. At Phase II, the subject is constantly eating. Phase III symptoms are attempts to eat anything nearby, regardless of whether or not the item being devoured would normally be considered food. Porneia (Lust) – The subject develops extremely heightened libido. Phase I symptoms are minor feelings of sexual arousal. At Phase II, subjects begin to experience hypersexuality and lowered sexual inhibitions. At Phase III, subjects will actively seek out sexual gratification by any means necessary, while simultaneously ignoring other bodily needs. While no subjects have remained in Phase III for long enough to confirm this, it is conceivable that an individual suffering from Phase III Porneia effects could starve to death as a direct result of their symptoms. Philargyria (Avarice) – The subject develops excessive greed. Phase I symptoms consist of heightened desire for wealth, status, and power. Phase II symptoms consist of attempts to acquire material possession through theft, bribery, or other means. Hoarding is common. Phase III symptoms are extreme attempts to obtain wealth, often including violence, trickery, and/or manipulation of authority. Hyperephania (Hubris) – The subject develops extreme pride. Phase I symptoms are minor feelings of pride. Phase II symptoms include a tendency to shame others as being inferior, and a sense of gratification for doing so. Phase III symptoms include more extreme manifestations of Phase I and II symptoms, as well as insolence, contempt, and a tendency towards violence against anyone who is perceived to have disparaged the subject. Lype (Envy) – The subject develops extreme negative emotions at the good fortune of others. Phase I symptoms are minor feelings of jealousy. Phase II symptoms include underhanded attempts to engage in character assassination of those to which the subject feels jealous. Phase III symptoms are characterized by extreme negative behavior, including strong and persistent attempts at causing misery towards the object of the envy, and sometimes violence. Orge (Wrath) – The subject displays intense and unstoppable rage. Phase I symptoms are minor feelings of annoyance and irritability. At Phase II, subjects become pugnacious, though physical altercations are rare. Once Phase III has been reached, subjects will respond to the slightest trigger with extreme fury, which can result in attempts to kill those nearby. Kenodoxia (Vanity) – The subject holds an excessive belief in his/her own abilities and/or attractiveness to others. Phase I symptoms include a feeling of superiority. Phase II involves unjustified boasting. At Phase III, subjects descend into extreme • • • • • • • • • • self-idolatry. Note: While subjects displaying Kenodoxia tend to not cause direct harm to themselves or others, they tend to cause sufficient irritation in those around them that it is not uncommon for others to cause them harm. Akedia (Sloth/Dejection) – The subject suffers from extreme laziness and despair. Phase I symptoms include procrastination and minor feelings of sadness. Phase II symptoms are consistent with extreme cases of general depressive disorder; the subject has extreme difficulty mustering the energy necessary to perform nonessential tasks. At Phase III, the subject becomes catatonic. History: Evagrius wrote the Peri Logismon as a guide for understanding and learning to overcome temptation. Records recovered from the dig site (see [REDACTED]) suggest that SCP-1215 was an attempt by Evagrius to create a morality tool for use by the mostly illiterate general population. Though SCP-1215 has demonstrated effective for its purpose, records found alongside the manuscript suggest it was written earlier (approximately 373 CE) than the more widely known version of the Peri Logismon (written 375 CE). According to the records found alongside SCP-1215, Evagrius (then still a lector in Neocaesarea and a disciple of Basil of Caesarea) created SCP-1215 and presented it to Basil. Basil (329 or 330 CE – January 1, 379 CE), an influential theologian later canonized as St. Basil the Great, apparently rejected his pupil's creation, instructing it to be sealed away and that all subsequent versions of the work had to be substantially censored. Evidence of this censorship can be seen clearly in Chapter 16 of the Peri Logismon, where Evagrius writes, "I cannot write about all the villainies of the demons; and I feel ashamed to speak about them at length and in detail, for fear of harming the more simple-minded among my readers." After Basil died in 379 CE and Evagrius moved to Constantinople in 380, it appears SCP-1215 was forgotten until it was rediscovered in modern times. SCP-1215, as well as the history surrounding it, reinforces theories that the early Christian church was involved in the containment of paranormal and preternatural items. St. Basil of Caesarea, who holds a very important place in the history of Christian liturgy and is regarded as a father of communal monasticism in Eastern Christianity (as well as a major influence on St. Benedict in Western Christianity), is credited with having written no fewer than three Prayers of Exorcism. Evagrius, beyond being the original author of what would eventually become a major tenant of Catholicism (the Seven Deadly Sins) and being a major influence on many later church figures, was accused of heresy later in life for his esoteric speculations regarding the pre-existence of human souls. The extent to which the early Christian church's possible efforts to contain items of paranormal and preternatural natures affected the development of Christian ethics, practices, beliefs, and Western culture as a whole, is unknown at this time. « SCP-1214 \| SCP-1215 \| SCP-1216 » _ccartisticdocumenteuclidmind-affectingreligiousscpsexual page revision: 25, last edited: 06 Jun 2017 09:52 Edit Rate (+82) Tags Discuss (34) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. • Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1216 rating: +185+–x Symbol reconstructed from painted fragments of concrete that were broken when SCP-1216-1 was created. Believed to represent an instance of SCP-1216. Item #: SCP-1216 Object Class: Safe Special Containment Procedures: A base of operations, Site-144, has been established surrounding SCP-1216-1. Instances of SCP-1216 may be retrieved at a limit of three per day. In the event of explorations into SCP-1216-2, personnel are to be equipped with Environmental Protection Ensemble 12 (Desert). Instances of SCP-1216-4 are to be tracked by satellite from Site-144 and, when located, temporary containment is to be set up. Temporary SCP-1216-4 containment is to consist of a concrete-moored gap-free wooden fence circumscribing the instance's range. Given the nature of the sites at which instances of SCP-1216-4 appear, civilians are to be removed from the premises of any SCP-1216-4 containment site under the artifice of enforcing industrial safety standards. Upon dissipation of an SCP-1216-4 instance, temporary containment is to be ended. In the event that there are no suitable sites left for the appearance of instances of SCP-1216-4, replica sites are to be constructed in secure facilities and continually replenished with scrap metal. Description: SCP-1216 is a species of pyramidal organisms native to an extradimensional space adjacent to Lenox, Massachusetts. However, they do not exhibit several characteristics of living organisms, among them reproduction and metabolism. The organisms range in scale from 5cm tall and .33kg to ca. 700cm tall and 7540kg, but are otherwise identical in appearance and proportions. Instances of SCP-1216 have a square pyramid body with a base length exactly 1.5 times its height, with a thin, flexible, bowed leg on each lower vertex. Their legs are cylindrical and allow them to move in any direction without turning their bodies. They also have a pair of curved, cylindrical, flexible antennae attached to the uppermost vertex of their body. Situated at the ends of the antennae are two solid spheres composed of beryllium bronze with density 8.78g/cm³. Except for the beryllium bronze spheres, instances of SCP-1216 are composed of an anomalous protein, henceforth pyramitin, which seems to be similar in structure to chitin, except that it has a bulk modulus and density comparable to that of cobalt. Pyramitin partially blocks EM radiation and does not break down chemically, frustrating spectrographic, electromicroscopic, and chemical analysis. From macroscopic observation, it is dark gray, non-reflective, non-porous, and always cool to the touch. On the underside of the body is a conical mouth containing a proteinaceous turbine. By spinning this turbine, instances of SCP-1216 are able to generate suction. Above the turbine there is a dense, wrinkled mass of pyramitin which is impenetrable to both scans and dissection. The turbine and the mass above it appear to be the only internal organs — the rest of the hollow body cavity is filled with sand and particles of iron oxide. The extradimensional space to which SCP-1216 is native, SCP-1216-2, is an unbounded flat expanse of subtropical desert. The expanse is lit by a small, stationary sun located at 48° above the horizon and 66° east from due south, heating it to a constant 26° C. These measurements remain the same no matter how far or in what direction one travels. It is of note that powered flight is not possible within SCP-1216-2 — by process of elimination it appears to be an unknown quality of the atmosphere. At current estimates, there are about 5100 instances of SCP-1216 of various sizes inhabiting SCP-1216-2. SCP-1216 typically scuttle around the expanse in random patterns. On a constant basis, pieces of manmade scrap metal — ranging from nuts and bolts to the chassis of heavy construction machinery — emerge from the sand and are consumed by SCP-1216 through turbine suction. SCP-1216 gain no mass from consumption — X-ray fluoroscopy scans show the metal entering the dense organ in the center of the body and subsequently disappearing. SCP-1216 are able to communicate with one another through flexing their antennae and tapping their beryllium bronze spheres together in rhythmic patterns. This produces a clicking sound that echoes for a far longer time than can be replicated. Larger instances of SCP-1216 produce deeper sounds, move more slowly, and eat larger pieces of scrap metal. SCP-1216 do not regard humans as threats and make no attempts to interact with them. SCP-1216 that were deliberately assaulted by D-class test subjects had no significant reaction and took no action against the D-class. When scrap metal was taken from SCP-1216 as they were about to consume it, they lost interest and found other pieces. Several instances of SCP-1216 have been successfully captured, transported into Site-144, and dissected with no resistance offered by the individual or the group. "Dead" instances of SCP-1216 — the term is ambiguous given their lack of life signs, although they do stop moving when dissected — are replaced after some time by SCP-1216-3. The main feature of SCP-1216-2 is SCP-1216-3, a 400m tall pyramid composed of the same protein as the instances of SCP-1216 and with the same proportions. Aperiodically SCP-1216-3 will slowly excrete instances of SCP-1216 from its surface — these will stay the same size at which they were created. SCP-1216-3 is wholly impenetrable to all scans. It remains cool despite being in perpetual sunlight. SCP-1216-2 is accessible through an irregularly shaped portal, SCP-1216-1, about 1.3m wide and 2.5m tall in a broken section of concrete wall in the first floor of a parking structure in Lenox, Massachusetts. Its existence was first noted shortly after Lenox was affected by the 2011 Virginia earthquake. Subsequently, several stray instances of SCP-1216 exited it and were captured on security camera, thus alerting the Foundation to their, SCP-1216-1's, and ultimately SCP-1216-2's existence. From inside, SCP-1216-1 floats 3cm above the ground and is effectively flat. It has depth — its inner edge is made of the concrete wall — but it is only visible when facing its opening, and cannot be seen from the back, even though the non-visible side feels like a solid barrier. Likewise, on the other side of the concrete wall, the hole simply allows one-way sight but not passage through it — it feels solid. Passing through the portal offers no adverse effects to human life. At intervals of 2 to 5 days, a secondary portal to SCP-1216-2 will be established at any location on Earth which contains large amounts of discarded scrap metal — e.g. junkyards, shipwrecks or garbage dumps. This secondary portal, known as an instance of SCP-1216-4, manifests as a whirlpool of desert sand at the lowest point of the area. SCP-1216-4 may be between 3m and 12m in diameter. All solid unsecured matter within a range of twice the diameter is then sucked into SCP-1216-4, ultimately reemerging in the extradimensional space. The reason why only scrap metal emerges from the ground in SCP-1216-2 is as of yet unknown; non-metallic matter, including organic matter, does not appear in the expanse and is presumed lost. When all available matter has been sucked into SCP-1216-4, it consumes itself and shrinks in size until it has vanished, leaving no trace. Instances of SCP-1216-4 started appearing only after SCP-1216-1 opened. « SCP-1215 \| SCP-1216 \| SCP-1217 » _ccautonomousbuildingextradimensionalpolyhedralportalsafescpself-replicatingspecies page revision: 11, last edited: 06 Jun 2017 09:52 Edit Rate (+185) Tags Discuss (41) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1217 rating: +102+–x SCP-1217-1, prior to Foundation involvement. Item #: SCP-1217 Object Class: Safe Special Containment Procedures: A barbed-wire fence with a single gate to allow authorised access is to be maintained in an area surrounding SCP-1217’s active zone, around which several chemical hazard signs are to be placed in clear view. Multiple CCTV cameras are to be set up in a perimeter around SCP-1217’s active zone, monitored by a nearby Observation Post (OP 1217-Alpha). A minimum of two guards are to be present at this station at all times. Any unauthorised individuals attempting to enter SCP-1217 are to be detained, interviewed and – if they present no clear threat – released after being provided with a Class-C amnestic. Several enclosed rooms near the entrance of SCP-1217-1 have been modified and equipped with observational apparatus to serve as testing chambers – any experimentation involving SCP-1217-2 is to take place only in these designated areas (please refer to Document 1217-A). Subjects should be placed into these chambers, released, and monitored. After the experiment is complete, the refuse is to be removed and disposed of via incineration. Description: SCP-1217 consists of two parts: SCP-1217-1, formerly an office complex owned by the █████████ Corporation, located in [REDACTED], Massachusetts, US. The 250 m × 300 m area surrounding SCP-1217-1 is considered SCP-1217’s active zone. SCP-1217-2, any member of the species Felis catus which enters SCP-1217’s active zone. Upon entering the aforementioned area, a specimen of SCP-1217-2 will display no significant behavioural deviations from its previous activity, apart from attempting to remain within the active zone of SCP-1217 and responding aggressively to any attempts to remove it from said area. Removal is still possible; however, successfully removing a subject from the area will not prevent the anomalous event associated with SCP-1217 from occurring. Fifteen to twenty minutes after entering the area, specimens will begin acting in a notably erratic manner, which typically involves spontaneous pouncing and vocalising. Several minutes following this, subjects will protract their claws and attempt to repeatedly lacerate their underbelly. Shortly after this begins, specimens will (if unimpeded) succeed in disembowelling themselves, despite pain, shock or other associated sensations which would result. The viscera and blood released from the aforementioned process will invariably form itself into a shape resembling a short, semi-coherent sentence, consisting of English • • characters. Said messages vary between instances of SCP-1217-2, and possess occasional notable spelling and grammatical errors. The text constituting these sentences largely consists of blood, which will retain this shape if left undisturbed until drying. Extracts of other organs – particularly the colon and intestinal tracts – have been known to fold in such a way to form appropriate letters if cut from the original lacerations, though this is a rare occurrence. Excess tissue does not appear to be affected, and pools normally a short distance away from the remaining substance. The means by which the aforementioned viscera assumes shape of coherent text is currently unknown. The anomalous properties of SCP-1217 came to the attention of the Foundation on 2005-██-██, when a stray cat entered its active zone before initiating expected behaviour in front of several █████████ employees. The building was then transferred into Foundation possession, relevant witnesses were administered Class-B amnestics and a cover-story regarding the discovery and continued removal of asbestos within the building was released. Excerpt from Document 1217-B: Note: The following are copied as accurately as possible from the original text, produced as a result of successive tests. For an extensive log of all messages produced, please refer to the relevant documentation. Test ██ Is thsi it? Test ██ why can't it? Test ██ Can I play too? + Incident 1217-1 Between Tests 13 and 19, the text produced by SCP-1217 began deviating significantly from its previously established pattern, as follows: Test 12 what happens nuw? Test 13 I’m sick of this. Test 14 I’m sick of making them talk. Test 15 I want to stop for now. Test 16 Stop it. Test 17 STOP Test 18 STOP Test 19 STOP Shortly after this, Dr. ███████ requested an extended reprieve from experimentation, which was approved by O5-█. Testing was stopped between 20██-04-██ and 20██-07-██, at which point it was resumed. The resulting text appears to be consistent with the usual pattern of that produced by SCP-1217: Test 20 i’m so sorry. Test 21 it's all lost he htaes us. Test 22 let us go. « SCP-1216 \| SCP-1217 \| SCP-1218 » _ccbuildingfelinesafescp page revision: 36, last edited: 14 Mar 2020 13:21 Edit Rate (+102) Tags Discuss (34) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1218 rating: +180+–x Item #: SCP-1218 Object Class: Safe Special Containment Procedures: All instances of SCP-1218-1 are to be kept within specially fitted crates in protected storage wing L-03 of Site 28. Most instances of SCP-1218-1 are fragile and care should be taken when retrieving, transporting, and storing them. Due to the potential for information leaks, instances of SCP-1218-1 must remain covered when in presence of any sensitive Foundation material. Any contact with or appearances of SCP-1218-2 are to be recorded and logged. Description: All instances of SCP-1218-1 are numbered as SCP-1218-1-XX in the order they were recovered. As of the most recent update of this document, SCP-1218-1-1 through SCP-1218-1-32 are in storage, minus only SCP-1218-1-4 (see Testing Logs). Instances of SCP-1218-1 all appear to be normal wall-mounted mirrors, most frequently rectangular, with sizes between 0.2 and 9.5 square meters. Upon closer inspection, the objects are in fact one-way reflective glass, with an extremely dark room visible on the far side when viewed in absolute darkness to minimize reflections. The dark rooms, hereafter known as 'viewing chambers', appear to have floors and ceilings of a cracked, concrete-like material with various raised platforms that SCP-1218-2 sit on. There are no side walls visible, with viewing distance tapering off quickly into darkness. Each mirror appears to link to a unique viewing chamber sharing these same characteristics. SCP-1218-2 refers to the group of creatures between 1.5 and 1.9 meters tall that are frequently visible in the viewing chambers. They appear humanoid with heavily jaundiced skin of a leathery appearance that obscures defining features. Each creature has four wounds on its head, holes ringed in torn flesh, that are roughly equivalent in position to a human's eyes, nose, and mouth. The creatures, hereafter referred to as 'the yellow men', wear moth-eaten suits identified as those in style during the 19██'s. SCP-1218-2 appear aware of viewers in front of SCP-1218-1 and have been seen to not only follow the movements of test subjects, but to actively take notes in what seems to be a ████ brand notebook. Dr. ███████’s recovered testing logs █/█/██: We've ruled out the idea of some sort of projection. Test subjects moving to different positions had their field of view through the mirror change accordingly. The subjects were visibly startled when SCP-1218-2 followed their movements, leading one to panic and one to scream. Lights were brought up and subjects removed from test chamber. █/█/██: It appears that at light levels below 1 Lux our test subjects start to become uneasy around SCP-1218-1. They describe either the feeling of being watched, or of the room being larger than it appears. I theorize that their subconscious is picking up on subtle visual clues of the 'viewing room' beyond the mirrors that is still too overwhelmed by reflections for their conscious brains to identify. I have rigged up the testing room with hidden low-light cameras which are able to pick up just enough light to make their tapes worthwhile for repeat studies. █/█/██: Continued testing on multiple instances of SCP-1218-1 suggests that each is linked to a separate room; though the number of viewing SCP-1218-2 changes, suggesting that they may enter and leave the rooms throughout the day. Also of note, it appears that the primary mode of lighting that allows the 'viewing room' to be seen is the embers of a cigarette. If none of SCP-1218-2 are smoking it stands to reason that the viewing room would be pitch black. It's possible that this accounts for the instances when we are unable to see anything through the mirror, even in utter darkness. █/█/██: So far I've managed to identify at least 19 unique SCP-1218-2 from the viewing logs. Their facial and body structures are extremely similar, but blemishes on the skin, height, and the suits they're wearing are enough to distinguish one from another. Note that these individuals do not always appear in the same viewing room. █/██/██: Testing on D class subjects so far has found no adverse effects from exposure to SCP-1218-1 or SCP-1218-2. I have therefore decided that it is safe for my assistants and I to perform tests directly. █/██/██: Given the quantity of SCP-1218-1 we've received, I have approved testing to try breaking one to see if it retains its effects. █/██/██: Shattering an instance of SCP-1218-1 does cause it to cease displaying any anomalous effects; however [REDACTED], like rotting fruit, which quickly dissipated. █/██/██: One of my assistants came to me today with something I had missed in the early experiments. She noticed that when subject D-9002 screamed in fright, one of the yellow men stepped back suddenly, as if startled. I wonder if perhaps sound might connect these locations as well. ██/█/██: I've added a laser microphone to the complement of recording devices trained on SCP-1218-1-5. We've picked up the following anomalous sounds [See Audio Log Summary] ██/██/██: SCP-1218-2 continue to intrigue me. They respond to my actions as if they can see me clearly, though personally I don't know how they can see anything; the low light has made it impossible to determine as of yet if there are in fact eyes beneath those shredded sockets. It's like watching animals at a zoo, they move to follow our actions, but don't reciprocate any attempts to communicate. I'm curious what they're writing, it's too bad there isn't enough light to read it. ██/██/██: More instances of SCP-1218-1 continue to be brought in. Now that we know their properties, we've begun going through old reports from ███████ and ████ database to gather more leads. Mobile Task Force Beta-6, the "Window Washers" has been created to not only collect more of these mirrors, but to try and trace their origin. █/█/██: I'll have to go through my notes, but it seems like there are more SCP-1218-2 than usual appearing for my tests. █/█/██: We have 26 instances of SCP-1218-1 in storage as of this date, having exhausted preexisting leads. I worry that, given the difficulty in noticing the effects, that there could be many more out there. █/██/██: I know there are more now, the most recent test had over ten of them, watching. I don't like this. I've taken the testing tapes home by [REDACTED], and I'm going to pore over every frame till I find something of use. █/██/██: I've spent the last three nights poring over the tapes. I think the lack of sleep is getting to me; I was walking past the mirror in hallway H-7 today and I could have sworn I saw something looking out at me. █/██/██: I broke the mirror in the hallway, at least now I'm sure. █/█/██: I figured it out, I should have been looking closer at the details on their [REDACTED]. I'm not sure, but I might know where, and what, they are. [End of record] See Incident H1218-A Audio Log Summary The following noises were picked up by the laser microphone over a seven (7) day period. Sound analysis software has been used to identify the most likely source of each sound, as well as its likelihood of accuracy, and the number of times it occurred. Footsteps (socks) - 99% - Coincided with movement of test subjects Footsteps (loafers) - 95% - Usually coincided with movement of SCP-1218-2 Dripping water - 99% - Continual Animal noise (cat, purr) - 18% - Frequent Running water (faucet) - 92% - 42 Chewing (human, adult) - 12% - 40 Voices (adult, unintelligible) - 80% - 30 Falling item (rubber tubing) - 14% - 29 Running water (shower) - 90% - 13 Machinery (forklift) - 87% - 12 Voices (children, unintelligible) - 84% - 11 Snoring (adult) - 93% - 7 [REDACTED] Laughter (children) - 93% - 2 Siren (ambulance) - 92% - 2 SCP-███ - 64% - 1 Shaking chains - 88% - 1 Shattering glass - 92% - 1 Voice (adult, female, "[unintelligible]…other one, we're going to be late") - 82% - 1 Scream (adult, female) - 83% - 1 • • • • • • • • • • • • • • • • • • • • + Incident H1218-A On █/█/██ Dr. ███████ was found dead at his private residence. He was discovered hanging by a noose in his attic after failing to show up to work for three days. Forensic evidence at the scene suggested suicide. Every single mirror in his house was found shattered. According to standard protocol, further testing on SCP-1218 is to be postponed until all possible memetic or mental influence is ruled out. Addendum A: Additional scrutiny of the mirror fragments of the home of Dr. ███████ find that [REDACTED] inconsistent with being shattered by a blow or weapon. The video logs were also missing from the scene. Additional investigations are underway to ascertain all the details of H1218-A. Addendum B: SCP-1218 is pending upgrade to Euclid status. « SCP-1217 \| SCP-1218 \| SCP-1219 » ‡ Licensing / Citation Cite this page as: "SCP-1218" by Crythis, from the SCP Wiki. Source: https://scpwiki.com/ scp-1218. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxartifacthumanoidsafescp page revision: 33, last edited: 21 Oct 2022 08:22 Edit Rate (+180) Tags Discuss (56) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1219 rating: +57+–x Item #: SCP-1219 Object Class: Euclid Special Containment Procedures: SCP-1219 is to be contained within a sealed area (min. size 2m3, max. size 5m3) in complete darkness (light level ≤ .0001 lux), situated at least 1 kilometer from any other occupied dark area. This chamber should be outfitted with overhead lighting controlled by an external switch. As of ██-██-██ SCP-1219 is housed at Storage Site-██. Personnel entering the darkened containment area for testing purposes must refrain from vocal utterances unless otherwise instructed by research staff. Description: The entity or event labeled SCP-1219 may manifest at any time within a sufficiently dark area of a suitable size (determined to be minimum 2m3; maximum unknown), provided at least one sentient being is present to witness the phenomenon. SCP-1219 manifests as a whistled version of the song Camptown Races which rises gradually and erratically in volume until audible to those present in the area. The entity or event will not manifest in the presence of an infrared camera or other low-light recording devices. No anomalous effects have been noted in relation to audio recordings of SCP-1219. Once triggered, the whistled song lasts for an apparently unlimited duration, generally until light exposure occurs. However, the song will cease within 10-20 seconds if a witness or witnesses attempt to whistle, hum, sing, or otherwise engage with SCP-1219's tune, and the witness(es) will be dismembered (stripped primarily of organs related to vocalization) and severely flayed with marks similar to those inflicted by a bullwhip along the neck, back, and legs, resulting in immediate or delayed death in 100% of observed cases. SCP-1219's whistle does not appear to compel this engagement. Dismemberment and flaying occurs rapidly and cannot be prevented by the introduction of light to the containment chamber. No physical component to SCP-1219 has been recorded or identified. SCP-1219 has been found capable of instantaneous transfer within a distance of approximately 1km. If exposed to light, the entity or event will cease immediately and recur in the nearest suitable dark space inside its transfer range. If no such space is available, SCP-1219 appears to enter a passive state and will not recur unless and until an accessible area meets all criteria for manifestation. Researchers speculate that SCP-1219 may be permanently incapacitated via constant illumination of this 1km area. No termination attempts are scheduled at this time. Acquisition Log 1219-1: SCP-1219 was first documented on 08-16-████ at ███ █ █████ St., an apartment complex in ██████, ██. A paranormal investigations team from the television series █████ ███████ responded to residents' claims of unusual activity. Reports from residents match the Foundation's current knowledge of SCP-1219. The Foundation acquired the team's unaired footage; a partial transcript follows. Acquisition Log 1219-1a - █████ ███████ Team, Camera B: <VIDEO LOG BEGINS - timestamp 22:18:29> [infrared footage shows a brief shot of a man's face, then swings around to show a room containing a twin-sized bed in the shape of a racecar, a bookshelf (book spines unreadable), and a wall shelf lined with action figures; the camera is aimed from the foot of the bed toward the far wall] Team member ████████: Is this- here we go. I'm all set up in the second bedroom in apartment ███ with the infrared camera, my trusty EMF reader, a couple thermometers, and an EVP recorder… [shot pans down to electronic equipment on the floor] Team member ████████: So we're gonna pick up changes in the electromagnetic fields, cold spots, and we're hoping for some nice clear sounds tonight… They told us this is where the, uh, event, occurs pretty often, so we're gonna settle in and see if we get any unusual recordings. [Transcript cut to timestamp 01:27:05] Team member ████████: So, we've been here about three hours… ███ says he's caught some temperature fluctuation in the master bedroom, but I haven't seen much activity in here, just a quick dip in- hang on, battery light's blinking on the camera. We'll have to rely on the tapes for a minute here. <VIDEO LOG ENDS - timestamp 01:28:44> Acquisition Log 1219-1b - █████ ███████ Team, Sound Recorder B: <AUDIO LOG BEGINS - transcribed following video log timestamp 01:28:44> [muffled clacking] Team member ████████: Batteries, batteries… shit. [unintelligible vocalization] Researcher's note: volume increase and audio filter on acquired tapes shows the entity or event manifests at approx. 01:28:45 with fluctuating decibel level of 10-40. Net rise in decibel level brings the sound into audible human range after approx. 9 seconds. [at second chorus, team member ████████ begins humming Camptown Races, slightly off-key, decibel range 44-50] [team member ████████ ceases humming; SCP-1219 heard clearly against ambient sound] Team member ████████: [calls] ███, are you- [SCP-1219 ceases; loud clatter] Team member ████████: [unintelligible scream] [heavy crash] Team member ████████: [gurgling speech] [REDACTED - see Acquisition Log 1219-1b-2] <AUDIO LOG ENDS> Upon Mobile Task Force Pi-1's arrival, Class A amnestics were administered to all surviving civilian parties involved. Human body and skin shreds as well as partial lip, vocal cord, and lung fragments were recovered from the site; testing positively identified them as the remains of investigation team member ████ ████████. The remains showed no anomalous properties. SCP-1219 was transferred to Storage Site-██ on ██- ██-████ via darkened transport unit and successfully contained without incident. Acquisition Log 1219-1b-2 access restricted to personnel with Level 3 Clearance and above + Acquisition Log 1219-1b-2 Upon study, researchers found investigation team member ████ ████████'s initially unintelligible final words to be coherent, if hampered by SCP-1219's effects. A full transcript of Acquisition Log 1219-1b follows. <AUDIO LOG BEGINS - transcribed following video log timestamp 01:28:44> [muffled clacking] Team member ████████: Batteries, batteries… shit. [unintelligible vocalization] Researcher's note: volume increase and audio filter on acquired tapes shows the entity or event manifests at approx. 01:28:45 with fluctuating decibel level of 10-40. Net rise in decibel level brings the sound into audible human range after approx. 9 seconds. [at second chorus, team member ████████ begins humming Camptown Races, slightly off-key, decibel range 44-50] [team member ████████ ceases humming; SCP-1219 heard clearly against ambient sound] Team member ████████: [calls] ███, are you- [SCP-1219 ceases; loud clatter] Team member ████████: [unintelligible scream] [heavy crash] Team member ████████: [gurgling speech] S-sorry… I… m so- rry. So- [unintelligible] <AUDIO LOG ENDS> Transcript redacted on ██-██-████ after all Class D experimental subjects exposed to SCP-1219's effects made similar final utterances for reasons unknown. All D-class subjects expired prior to full interrogation. Further testing and background investigation of SCP-1219 recommended. « SCP-1218 \| SCP-1219 \| SCP-1220 » ‡ Licensing / Citation Cite this page as: "SCP-1219" by Daedalus Shank, from the SCP Wiki. Source: https:// scpwiki.com/scp-1219. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxacousticeuclidhostileintangiblelightmobileobservationalscp page revision: 11, last edited: 21 Oct 2022 09:12 Edit Rate (+57) Tags Discuss (41) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-122 rating: +411+–x close Info X Content warning: This article contains mentions of suicide. Reader discretion is advised. rating: +411+–x content warning Item #: SCP-122 Level 1/122 Object Class: Thaumiel Classified SCP-122. Special Containment Procedures: Under no circumstances is SCP-122 to enter an unpowered state. At least one redundant failsafe power system is to be installed in order to maintain power to the object in the event of power outages. Regular maintenance is also to be conducted on SCP-122 at the discretion of the head researcher in order to reduce flickering. A security camera is to be installed within the room that the anomaly is placed so as to regularly monitor the occurrence of flickering within the subject. Due to its utility and importance in assisting the psychological assistance efforts of Site-135, SCP-122 is to be used on a daily basis, with SCP-122-1 (currently Anna Talinn) being given normal humanoid accommodations within the SCP-122 containment cell at the discretion of the incumbent head researcher. Should the current SCP-122-1 subject become unfit for use with the object, a new SCP-122-1 subject must be procured as soon as is feasible. Description: SCP-122 is a plastic night light in the shape of a star, thought to have been manufactured between 1960 and 1980. When in a powered state, SCP-122 has been reported to be able to exude a sense of calmness, comfort, and safety to those within a roughly 20-kilometer radius. As such, it has been known to alleviate symptoms of currently prevailing psychological conditions in subjects. • Examples of these psychological conditions include: Psychological Stress Paranoia Phobias Anxiety Post-Traumatic Stress Disorder SCP-122-1, Anna Talinn However, these alleviating effects are only present when SCP-122 is within the same room as a child under the age of 14 who subscribes to the beliefs1 of traditional Abrahamic religions2. This aforementioned child subject, referred to henceforth as SCP-122-1, is currently seven year old Anna Talinn, who was procured into Foundation custody in 2017. When in SCP-122’s containment cell, SCP-122-1 has reported sightings of an “angel” in her dreams, henceforth referred to as SCP-122-2 (Refer to SCP-122 use records for further information regarding SCP-122-2). SCP 122-2 has also been reported as sometimes appearing within the dreams of personnel affected by SCP-1223. Based on reports, it has been associated with positive feelings such as that of security and relief4. From this, it can be inferred that SCP-122-2 is related in some part to the aforementioned positive effects. Since the beginning of SCP-122’s use in supplementing psychological assistance efforts in Site-135, annual personnel turnover rates have been reduced by 90 percent, with annual personnel suicide rates being reduced by 85 percent. With Site-135 having recorded the highest instances of either statistic of all sites prior to the use of SCP-122, the subject has been integral to the continued operation of the site. + Excerpts of SCP-122 use records SCP-122-1 Name: [DATA EXPUNGED] Age: [DATA EXPUNGED] Date of Use: 2/12/2017 SCP-122-2 Activity: [DATA EXPUNGED] Incident Notes: [DATA EXPUNGED]. Positive effects of SCP-122 noted. Electronic failsafe systems implemented soon after. SCP-122-1 Name: Anna Talinn Age: 2 years old Date of Use: 3/01/2017 SCP-122-2 Activity: None. Incident Notes: No instances of flickering or dimming. SCP-122-1 was noted to be sleeping without incident. SCP-122-1 Name: Anna Talinn Age: 3 years old Date of Use: 4/28/2018 SCP-122-2 Activity Description: “God said he'd give me a guardian angel. And he did! Last night, there was a beautiful angel with wings and he was just standing there, and he was looking at me… beside the door! He did that alllll night!” Incident Notes: One instance of dimming. • • • • • SCP-122-1 Name: Anna Talinn Age: 5 years old Date of Use: 6/26/2020 SCP-122-2 Activity Description: “I saw the angel again today! He was at the edge of my bed, and he was looking at me with the widest smile on his face. His wings were… (stretches arms out) this big! I never realized they were that big before!” Incident Notes: Two instances of dimming, one instance of flickering. SCP-122-1 Name: Anna Talinn Age: 7 years old Date of Use: 9/15/2022 SCP-122-2 Activity Description: “He sat in front of me, just looking at me and watching me sleep. He looked like he wanted to hug me, and I wanted to hug him too!” Incident Notes: Four instances of flickering. However, SCP-122’s components have degraded in the time since its creation, with materials that could be used to replace them no longer being manufactured in the present. This degradation renders SCP-122 vulnerable to fluctuations in its brightness, with flickering and dimming being reported to be the most frequent fluctuations. This causes SCP-122 to assume an unpowered state. When in an unpowered state, SCP-122 [REDACTED]. WARNING: THE FOLLOWING FILE IS LEVEL 4/122 CLASSIFIED ANY ATTEMPT TO ACCESS THIS FILE WITHOUT LEVEL 4/122 AUTHORIZATION WILL BE LOGGED AND WILL LEAD TO IMMEDIATE DISCIPLINARY ACTION. Declassified SCP-122 Use Records (Updated) SCP-122-1 Name: Janna Marston Age: 6 years old. Date of Use: 2/12/2017 SCP-122-2 Activity Description: ”Had a blackout. He got her on the first night.” Incident Notes: Janna Marston lost. Proposal for new SCP-122-1 subject made. Positive effects of SCP-122 noted. Electronic failsafe systems implemented soon after. SCP-122-1 Name: Anna Talinn Age: 2 years old Date of Use: 3/01/2017 SCP-122-2 Activity: None. Incident Notes: No instances of flickering or dimming. SCP-122-1 was noted to be sleeping without incident. SCP-122-2 Distance: Undetected. Image of Greatest Activity: + OPEN ATTACHMENT? 3/01/2017 SCP-122-1 Name: Anna Talinn Age: 3 years old Date of Use: 4/28/2018 SCP-122-2 Activity Description: “God said he'd give me a guardian angel. And he did! Last night, there was a beautiful angel with wings and he was just standing there, and he was looking at me… beside the door! He did that alllll night!” Incident Notes: One instance of dimming. SCP-122-2 Distance: 6 meters Image of Greatest Activity: + OPEN ATTACHMENT? 4/28/2018 SCP-122-1 Name: Anna Talinn Age: 5 years old Date of Use: 6/26/2020 SCP-122-2 Activity Description: “I saw the angel again today! He was at the edge of my bed, and he was looking at me with the widest smile on his face. His wings were… (stretches arms out) this big! I never realized they were that big before!” Incident Notes: Two instances of dimming, one instance of flickering. SCP-122-2 Distance: 2 meters Image of Greatest Activity: + OPEN ATTACHMENT? 6/26/2020 SCP-122-1 Name: Anna Talinn Age: 7 years old Date of Use: 9/15/2022 SCP-122-2 Activity Description: “He sat in front of me, just looking at me and watching me sleep. He looked like he wanted to hug me, and I wanted to hug him too!" Incident Notes: Four instances of flickering. SCP-122-2 Distance: 6 centimeters Image of Greatest Activity: + OPEN ATTACHMENT? 9/15/2022 EMERGENCY ALERT: Site-wide blackout detected. CHECK SCP-122 STATUS ASAP. LAST IMAGE RECOVERED FROM SCP-122 CONTAINMENT CHAMBER + OPEN ATTACHMENT? "HE TELLS ME TO PRAY." Footnotes 1. Children who have shown to score at least an 8/10 on the Aglio-Pontiff Religious Belief Scale have been shown to display the best results as SCP-122-1 subjects. 2. The reasons for this specification are currently unknown, though a link may be established between this fact and previous descriptions of SCP-122-2 as an "angel" (see SCP-122 use records) 3. As of now, only younger personnel aged 20-25 have reported having sightings of SCP-122-2 4. However, sightings of SCP-122-2 within the dreams of personnel do not show the "progression" of distance and positive feelings reported by SCP-122-1. The reason for this is unknown More from this author Images created by AnAnomalousWriter and Luxaiko « SCP-121 \| SCP-122 \| SCP-123 » ‡ Licensing / Citation Cite this page as: "SCP-122" by Ecronak, from the SCP Wiki. Source: https://scpwiki.com/ scp-122. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. Name: Nothing better at the end of a working day than to dive into the Atlantic Ocean Author: Pedro Ribeiro Simões License: CC BY 2.0 Source Link: https://www.flickr.com/photos/pedrosimoes7/50327336561/ Name: Eye wide open on me Author: wladston License: CC BY 2.0 Source Link: https://www.flickr.com/photos/70973156@N00/283455759/ Filename: the_girl_who_wanted_me_to_take_her_picture_and_put_it_on_the_Internet Author: jesse.millan License: CC BY 2.0 Source Link: https://wordpress.org/openverse/image/0c18f842-2bb1-4266- a63b-f678048d7aa3 Name: Wing Author: Chris Cook License: CC BY-SA 2.0 Source Link: https://flickr.com/photos/chriscook4472/5514713814 _cc_licenseboxapplianceco-authoredelectricalhallucinationhumanoidlightmind- affectingreligiousrewritescpshadowsleepthaumiel page revision: 18, last edited: 04 May 2023 12:49 Edit Rate (+411) Tags Discuss (52) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1220 rating: +235+–x Item #: SCP-1220 Object Class: Safe Special Containment Procedures: SCP-1220 is to be contained in three (3) compact cassette cases, clearly marked with their designation. The cases will be sealed with tamper evident tape, and stored in a locking drawer along with all research notes pertaining to them. Due to the sensitive nature of SCP-1220, any recording of spoken SCP-1220 may not be digitized without permission from three (3) personnel ranking level four (4) or higher. If it is to be digitized, the data is to be stored on a computer with no or disabled network capacity, to prevent unauthorized access to SCP-1220. Pending further review, no personnel are permitted to expose themselves or others to SCP-1220. Description: SCP-1220 is an unknown, possibly dead language. It does not appear to belong to any known language family. It is a tonal language, similar to Mandarin, and shares a similar compounding structure for forming complex words. However, the number of phonemes used in SCP-1220 are far in excess of those used in any other language; some phonemes recorded appear to be unique, such as Phoneme ████ ("Chirp A"). Several of the phonemes are utterances which the human vocal apparatus was not meant to accommodate, yet the only known native speaker seems to have no difficulty reproducing them multiple times in rapid succession. The only known recording of SCP-1220 is a set of three cassette cases, containing two (2) hours and thirty four (34) minutes of recording. The recording is of a linguistic survey with an elderly woman. Interviewer begins by identifying the woman as one Ms. ████, and states that she is one of the last native speakers of a language identified only as ████████. The interviewer goes on to explain that Ms. ████ had offered to tell a story in her native language, and once more in English. His explanation complete, the interviewer sets the recorder down on the table, and Ms. ████ begins to tell the story. Once she has completed the story in SCP-1220, she repeats it once again in English, and the tape ends. The story is a variant on the 'global flood' story present in many Mediterranean cultures. The story outlines a great flood that covered the world, and one man who survived. The man, finding himself in a barren world, scooped up several handfuls of clay, and instructed them of their new purpose, whereupon the clay erupted into a handful of wheat, an ox, another human being, and [DATA EXPUNGED]. Recorded instances of SCP-1220, such as those on the tapes, appear to be inert and safe for study. However, when a living subject vocalizes in SCP-1220, a zone of anomalous space is produced. The mechanism behind the production of this zone is as yet undetermined, though the result is consistent with all test subjects. The zone has been measured extending as far away as 10m from the speaker, though the zone is generally smaller, averaging a sphere with a radius of 2m. The exact nature of the zone is dependent on the nature of the utterance. This property was discovered by Dr. █████ (1/1220), who on 9/5/████ pronounced morpheme ███ (Fire), whereupon the sleeve of his coat began to smolder. Dr. █████ was treated for second degree burns, and the coat has been placed in containment, where it continues to smolder. Following this incident stricter precautions were instated regarding access to SCP-1220, and testing proper began. For more information, refer to attached test logs. Addendum: Test log for Dr. ███████, 9/14/████ Test Subject: Jr. Assistant ██████, 1/1220 Native Language: English, American derivation Word Spoken: Morpheme ██ 'Rain' Result: Area around subject extending out to 3.11m experienced rainfall. Rain did not appear to originate from ambient atmospheric moisture, and fell at an angle suggesting wind, which was not felt outside of the zone. Subject initially reported that the rain was pleasantly warm, and initial sampling found that the precipitation was composed of water, with some particulate matter. Zone was found to follow subject, and that moisture left behind by the zones passage remained persistent, even after the anomaly ended. Subject reported skin irritation beginning one (1) minute after the end of the anomaly, which increased over time. Subject was washed in an on-site emergency shower, and was later treated for mild chemical burns. Examination of the precipitation sample afterwards revealed that the water became an aqueous solution of HCl. The recorded concentration of the sample was far higher than what was suggested by the Subject's reaction. Continued testing revealed that the HCl solution was increasing in concentration over time, until an hour after the end of the anomalous event, whereupon the contents of the sample contained only gaseous HCl. Note: Following the events of the test, protocols were revised to forbid testing by non-D Class personnel. Test log for Dr. ███████, 9/25/████ Test Subject: D-423/1220 Native Language: English, American derivation Word Spoken: Morpheme ██ 'Clay' Result: The ground surrounding D-423 out to 2.01 meters was transmuted into red clay. Effect began at the subjects feet, and radiated outwards. Wave continued until it reached anomaly boundary, whereupon it abruptly ended. Subject was asked to move around on the clay, which was found to be stable. The boundary of the anomaly shifted with the subject, with clay left outside of the anomaly rapidly transmuting back to its former state, while surfaces that entered the anomaly zone were transmuted into clay. Subject acquired a sample of the clay using a stainless steel trowel, which showed no signs of reaction. The sample was found to be soft enough to deform by hand. Once pressure was removed, the sample returned to its original shape, demonstrating a 'memory foam'- like quality. Subject reported that the clay felt abrasive, similar to large grit sand paper, even through the work gloves that D-423 had been issued. Sample was bagged and removed from anomaly zone. It remained clay upon removal, and is currently available for study. Five (5) minutes after the initial anomalous event, Subject reported piercing pain in left foot. On the spot inspection revealed an organism burrowing into the ball of D-423's foot, having pierced through 4cm of rubber to do so. The organism, designated SCP-1220-a, was removed via on site medical personnel, and placed in a sample bag, along with an additional sample of the clay. SCP-1220-a appears to be some form of terrestrial roundworm, measuring 6cm, possessing a hardened exoskeleton and an enlarged mouth, containing tooth-like growths similar in shape and function to a lamprey's teeth. SCP-1220-a is alive at time of writing, and currently available for study. Subject requested a chair, following encounter with SCP-1220-a. Request was authorized, and Subject remained seated for the remainder of the test. Ten (10) minutes after the initial anomalous event, Subject reported instability in chair. Shortly afterwards, the clay began to liquify, becoming quicksand-like in behavior. Subject was ordered to remain in place as the chair sunk into the clay. More examples of SCP-1220-a were spotted around the chair, as the area of transmuted clay began to recede. Subject at this point violated experimental procedure by leaping away from the chair, attempting to avoid immersion in the clay. The anomalous zone followed D-423 in flight, and upon landing subject was completely immersed in clay. Rescue attempts were considered, but before any plan could be put into action, the anomalous zone had disappeared. The fate of D-423 is currently unknown. The folding chair used in the experiment was severed by the movement of the anomalous zone, and the remaining pieces appear to have been separated from the rest of the chair as if by a very sharp blade. Test log for Dr. ███████, 10/4/████ Test Subject: D-424/1220 Native Language: Spanish, Mexican derivation Word Spoken: Morpheme █ "-ness/having the qualities of" Note: After the previous two tests, Dr. ███████ requested testing on non-nouns. Result: Anomalous zone not observed in this test. Subject reported a sensation of 'being watched', along with occasional scents similar to burning tires, and a greasy feel that traveled along the Subject's arm. Outside observers were unable to confirm any scent or oiliness before the anomalous event ended. Test log for Dr. ███████, 10/5/████ Test Subject: D-424/1220 Native Language: Spanish, Mexican derivation Word Spoken: Morpheme ██ compounded by Morpheme █ "Clayness/Having the qualities of clay." Result: Anomalous zone once again not observed during this test. Subject initially reported feelings of physical wellness, of 'sturdiness' and immovability. Two (2) minutes and twenty six (26) seconds after initial vocalization, Subject reported stiffness in limbs. Two (2) minutes later, subject's skin became clay-like, originating around the mouth and spreading outwards. Subject was unable to communicate with staff during the transmutation, which eventually encompassed the whole of D-424's body. Samples collected after the fact show that the transmutation was complete, and that all of D-424's mass was transformed into clay. Test log for Dr. ███████, 11/28/████ Test Subject: D-425/1220 Native Language: Mandarin Word Spoken: Morpheme ███ "Covenant/Communion/[DATA EXPUNGED]" Result: Immediately following vocalization, and continuing for thirty-three (33) seconds after vocalization, Research Sector-██ experienced seismic activity, recorded at 3.2Mw. Seismic event faded gradually, ceasing completely after two (2) minutes. Subject began to report sensations of contact, describing hands running over her skin. Staff within 10m of D-425 reported similar sensations. Sensations became overwhelming at four (4) minutes and fifteen (15) seconds, whereupon D-425 collapsed. Subject begins reporting visual, auditory, and tactile hallucinations. Hallucinations included: a flock of bats, covered in bleached bone plates, swarming around the subject; a city made out of melted green glass; a tall figure, with a head resembling a compound eye, surrounded by sourceless 'plates' of light. Upon reporting the last hallucination, the described figure became visible to all staff within the testing chamber. The figure seized the subject, and both vanished. Later review of security footage did not record the presence of the figure, designated SCP-1220-b Note: Further experimentation with SCP-1220 is suspended indefinitely, pending further review. Agents encountering instances of SCP-1220 in the wild are ordered to not engage with the speaker, and instead to notify the home office. Further actions will be handled on a case-by-case basis. « SCP-1219 \| SCP-1220 \| SCP-1221 » ‡ Licensing / Citation Cite this page as: "SCP-1220" by Pleroma, from the SCP Wiki. Source: https://scpwiki.com/ scp-1220. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxlanguagemediasafescp page revision: 17, last edited: 21 Oct 2022 08:05 Edit Rate (+235) Tags Discuss (40) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1221 rating: +183+–x Item #: SCP-1221 Object Class: Safe Special Containment Procedures: SCP-1221 is non-hazardous and contained in an Anomalous Vehicle Containment Bay at Site-██. Cleaning and maintenance is to be performed monthly; personnel are only permitted to enter SCP-1221 for these purposes and entrance is restricted to D-class. By O5-level directive, all use and testing of SCP-1221 has been suspended indefinitely. Description: SCP-1221 is a Mercedes-Benz O405 single-decker bus manufactured at the company's Mannheim plant in 1989. It was purchased by the ██████ Transit Authority and had an uneventful 10-year career. Upon its retirement SCP-1221 was acquired by the Foundation for staff transport (transport of SCPs or exposure to SCP incidents does not appear to have occurred). The operation of SCP-1221 is identical in all respects to a standard bus of its model. It attained SCP classification approximately 1 year after its acquisition, when medical staff noted a statistically significant increase in seizures at Site-██ which were traced back to users of the vehicle. 90% of subjects who enter SCP-1221 experience no visible effects. The remaining 10% are observed to develop a mild absence seizure disorder anywhere from hours to years after exposure. This is similar to typical absence seizure disorders, involving some seconds of loss of consciousness and blank staring without movement and showing characteristic patterns on EEG. Atypically, subjects commonly experience auras of déjà vu1 or jamais vu2 which are normally associated with other seizure types. Subjects retain no memories of the absences other than the occasional vague description of an 'out-of-body experience'. The disorder caused by SCP-1221 is in many respects more benign than otherwise: seizures are fairly rare, usually occurring yearly (although weekly seizures have been observed) and are invariably controlled with appropriate anticonvulsant medication. Many subjects may be weaned off anticonvulsants after prolonged treatment. A small number (<10%) of affected subjects are observed to vocalise during seizures (as no memory of the events are retained, consciousness appears to remain impaired), inconsistent with the presentation of typical absence seizures. Generalised EEG discharges are still observed. The vocalisations have a common theme of [DATA EXPUNGED]. LEVEL 4 CLEARANCE REQUIRED Interview Log 1221-1 Interview 1221-1 Dr. R███ was skeptical of SCP-1221's extranormal properties and volunteered to test its effects. He entered SCP-1221 without incident and was interviewed 2 weeks after exposure by Dr. Major. An abridged transcript of the interview follows. <Begin Log: 00h-00m-00s> Dr. Major: Morning, R███. How are you feeling today? Dr. R███: Same as always. No hallucinations, no blackouts, no seizures. Got up, had breakfast, did some reports and came in here. Dr. Major: Okay, no change this week, but it sometimes takes a while to set in. Had any strange memory issues lately? Dr. R███: <laughs> Nothing's going to happen and you'll say I'm part of the 90% who aren't affected! Memory's bad as ever. <00h-12m-32s> Dr. Major: Doesn't look like I'll get anything from you today. Time for a coffee? [Dr. R███ stares blankly and is unresponsive for a total of 13s. Dr. Major is aware Dr. R███ is unresponsive by 6s and makes a note. After 13s, Dr. R███'s face contorts violently, startling Dr. Major. Dr. R███ is now conscious but visibly fearful and agitated.] Dr. Major: R███, are you - Dr. R███: [distressed] Major? Jesus, they were right, they were all right about it. 1221. I can see him, it's not me. Dr. Major: Him? What are you - Dr. R███: It's somebody else, I'm not here. I just watch. You have to help me, Major. Help me. Help - [Dr. R███'s face violently contorts for a second time and returns to normal after 3s. Dr. R███'s mood has returned to its original state. The time is now 00h-14m-44s.] Dr. R███: I'm sorry, I must have drifted off for a moment. Dr. Major: What the hell was that? Dr. R███: Was what? [Dr. R███ appears to have no memory of the episode, despite repeated questioning. Video recording of the episode is shown to Dr. R███.] Dr. R███: Okay, Major, you got me there. I guess 1221 does cause the little seizures after all. Egg on my face, huh? Dr. Major: You don't have any comments on what you said during the episode? Dr. R███: No idea what it means, looks like I just went a bit loopy. Can I get going? This took ages and now I have get medical to fix this up. Don't want to scare you again! <laughs> Dr. Major: Uh, okay, R███. We'll continue this later. [Dr. R███ exits interview room. CCTV cameras in outside corridor appear to show him mutter 'nice try'.] <End Log: 00h-29m-11s> Additional Comments: Based on this report, I have attached a request for increased surveillance of SCP-1221 subjects, accelerated research (cross-SCP use with SCP- [REDACTED] may be necessary to obtain results) and a Euclid reclassification. - Dr. Major Request denied. Evidence that SCP-1221 has a major effect on subjects is lacking and barring the treatable seizure disorder subjects have universally normal appearance and behaviour. It is the opinion of this office that no beneficial data would be gained from further research. [REDACTED] civilians and ███ Foundation personnel, including [REDACTED] have been exposed to SCP-1221, all of whom have essentially normal function. Information may pose a containment risk and have negative effects on employee morale. SCP-1221 and 'affected' subjects are presently secure, contained and protected. Until the situation changes, testing is unnecessary and has been suspended. - O5-█ Footnotes 1. Feelings of familiarity with unfamiliar situations. 2. Feelings of unfamiliarity with familiar situations. « SCP-1220 \| SCP-1221 \| SCP-1222 » ‡ Licensing / Citation Cite this page as: "SCP-1221" by ModernMajorGeneral, from the SCP Wiki. Source: https:// scpwiki.com/scp-1221. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxmemory-affectingmind-affectingsafescpvehicle page revision: 17, last edited: 21 Oct 2022 07:56 Edit Rate (+183) Tags Discuss (38) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1222 rating: +34+–x Item #: SCP-1222 Object Class: Safe Special Containment Procedures: SCP-1222 is to be locked in a 60 x 60 x 60 cm hard plastic container with foam inner-lining to hold it in place. Container can be found inside locker ██ in the storage area of Site-4. If container is damaged in any way, contact administration for replacement. Personnel with Level 1 clearance or higher may access the object for research purposes. If not used for testing, linseed oil must be rubbed into SCP-1222 for preservation purposes once annually. Linseed oil must also be used after all research tests. Description: SCP-1222 is a bamboo box, decorated with beads and shells, and measuring 7 x 10 x 10 cm. A lid is attached and held together by a woven thread made of palm fronds. Any human who touches the box with both hands and gazes at its bottom will instantly enter a state of stasis, in which they cannot be repositioned or harmed by any means known to the Foundation; any human in this condition is to be classified as SCP-1222-1. This stasis will continue until SCP-1222-1 is touched by the skin of a live human. SCP-1222-1 has no vital signs (respiration, blood pressure, brain activity), and can remain in this condition indefinitely. Removing SCP-1222 from SCP-1222-1's hands, or blocking it from SCP-1222-1's view, does not affect the stasis. However, only one instance of SCP-1222-1 exists at a time; attempts to successively or simultaneously create multiple instances of SCP-1222-1 have failed. Examination of SCP-1222-1 through latex gloves has revealed that SCP-1222-1's flesh is hard and unyielding; researchers have described the flesh as being "like stone or metal". SCP-1222-1's clothing is unaffected by the stasis and can be damaged normally; however, hair becomes intensely tough and durable. + TEST LOG 1222-1 TEST: SCP-1222-T12 PROCEDURE: SCP-1222-1's head struck with metal rod 32 times. RESULT: No damage to SCP-1222-1; rod became warped and dented. TEST: SCP-1222-T14 PROCEDURE: Fired at with a .38 Special revolver RESULT: The bullet compressed against SCP-1222-1's right earlobe. SCP-1222-1 fell over. TEST: SCP-1222-T22 PROCEDURE: Fired at with an AR-10 rifle using 7.62x51 NATO rounds RESULT: The bullet shattered against SCP-1222-1's right shoulder. SCP-1222-1 fell over. TEST: SCP-1222-T30 PROCEDURE: Swiped at with 30cm kitchen knife RESULT: Knife bounced off. TEST: SCP-1222-T31 PROCEDURE: Stabbed with 30cm kitchen knife RESULT: Knife broke. TEST: SCP-1222-T50 PROCEDURE: Fluoroantimonic acid poured onto SCP-1222-1's back RESULT: Acid seeped off of the subject and into the glass container beneath. TEST: SCP-1222-T53 PROCEDURE: Partially submerged in Fluoroantimonic acid RESULT: Subject was asked to hold SCP-1222 above the head while entering stasis. Subject was lowered into a glass container two meters tall with one meter filled with fluoroantimonic acid. Test was conducted with safety measure to ensure no damage to SCP-1222 would occur. After two weeks of no reported changes, subject was removed, cleaned, and reawakened. Subject subsequently died due to accumulation of acid in pores of skin and lower cavities. TEST: SCP-1222-T63 PROCEDURE: Petrol ignited RESULT: A small quantity of petrol was poured over the subjects lower back and set alight. The area became scorched black with residue but no visible damage was shown. NOTE No further tests involving substances that could harm the box will be used unless under strict supervision of a safety team and class 3 personnel. This is only to prevent damage to the box and is not a personal attack on any researcher. TEST: SCP-1222-T68 PROCEDURE: A slap RESULT: Both a gloved and ungloved slap were given to the test subject. The gloved slap had no effect and managed to topple over the test subject. The ungloved slapped immediately awoke the test subject, who shrieked in surprise. When D-class personnel was asked to describe the feeling of slapping, he replied “like putting your hand through paper and immediately hitting flesh”. + RECOVERY LOG SCP-1222 was found in ██████████, a village of Nias Island located off the coast from the Sumatra region of Indonesia on November 18, 1984. A rescue team dispatched in the area discovered a dug out chamber beneath debris of a destroyed home. In the middle of the chamber was a Caucasian woman kneeling on the floor with the item in her hands. Report Excerpt ██-██-1984 We were relieved at first to find a survivor under all the rubble. A single mother had lived there with two children and an infant, and all four had perished when their home fell. A neighbour had reported that the mother was always talking about a disabled cousin she also cared for, and was worried for the cousin’s safety. After inspecting and moving the rubble, we found a hole in the corner of where the sleeping area would have been. The hole went down two meters before turning toward an entrance of a small chamber. The man who volunteered to go down called out that he had found a woman in prayer and that she was in shock. He then went to pick her up and take her out when the woman started screaming. When he emerged with her she was thrashing about and speaking in a language we didn’t recognise. She was without a scratch on her body, but her clothes were old and falling apart and a thick layer of dust covered all parts. The woman calmed down after we constrained her and was sent to an emergency medical centre set up nearby. Light amnestics were given to all members of the rescue team after receiving the report. The subject’s name is ████ ██████, born 4 June 18██. Agents acquired her at the emergency medical centre where she was transported to Site-4. The only item with her was SCP-1222. Subject spoke fluent Dutch that was standard for the 1800’s. When questioned about SCP-1222 she went into detail about finding it in a village not far from where she was found, after her father had [DATA EXPUNGED] retrieved it from the ashes. Subject was commissioned to D-Class personnel at Site-3. Addendum: Future tests are scheduled for use of radiation, destructive bacteria, nano-machines, and SCPs ████, ████, ████, ████, ████, ████ and ████. Various Keter class SCPs were also considered but decided against due to possibility of the damage or destruction of SCP-1222. « SCP-1221 \| SCP-1222 \| SCP-1223 » ‡ Licensing / Citation Cite this page as: "SCP-1222" by zidago, from the SCP Wiki. Source: https://scpwiki.com/ scp-1222. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxartifactcognitohazardsafescptactilevisual page revision: 23, last edited: 21 Oct 2022 08:09 Edit Rate (+34) Tags Discuss (53) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1223 rating: +183+–x Item #: SCP-1223 Object Class: Safe Special Containment Procedures: SCP-1223 is to be stored in a standard containment crate in the on-site warehouse of Site ██. SCP-1223 is to remain in an unpowered state when not undergoing approved testing. When undergoing testing requiring a powered state, SCP-1223 must be secured in a sealed testing area and monitored via video surveillance. While in a powered state, only D-Class personnel may directly view SCP-1223. Description: SCP-1223 is a digital photo frame manufactured by the █████ Corporation. Physical examination while in an unpowered state revealed no components unusual for other models of its product line. SCP-1223 possesses a solid-state hard drive with a capacity of 512mb and a 15x21cm LCD display. Electronic analysis of the hard drive determined that the drive is not storing any photo data. In a powered state, SCP-1223 will display a blue menu screen when unobserved, standard for photo frames of its type. Upon being directly observed by a living human being (hereby referred to as subject), however, SCP-1223’s LCD will alter to a flat black screen with the words “HELLO” in large white text. Experimentation has shown that SCP-1223 must be within direct line of sight of an individual to activate; remote monitoring does not trigger the effect. Within six seconds of observation, SCP-1223’s screen will again change, this time displaying a person or object from the observer’s life. The photo will be displayed until it is directly observed by the subject. Once observed, the photo will again change after six seconds, displaying another event from the subject’s life. SCP-1223 has displayed a tendency to display photos of close individuals, objects or places that the subject displays a strong affection for. Once observed for several iterations of photos, SCP-1223 will begin displaying plain text captions over the displayed images. Captions are typically descriptive in nature and written from the perspective of an outside observer addressing the subject. Recorded captions include: Your mom sure loved her gift! (Displayed image: An elderly woman opening a birthday present.) What a proud papa. (Displayed image: A young man holding a newborn baby girl.) He’ll always have your back. (Displayed image: Two soldiers posing for a photo atop a burned Iraqi tank.) This was the best night of your life. (Displayed image: A bride and groom exchanging vows.) Upon observing a photo from their life, the subject will begin to develop symptoms of retrograde amnesia. Subjects will have difficulty remembering the events pictured in the photo, and will react with confusion if provided evidence of them. Repeated viewing of photographs displayed by SCP-1223 will result in the subject losing all memory of the • • • • person, place or object that was featured in the photos. The exact number of displayed images required before total loss of memory of the person, place or object varies between subjects. In one case, D-58134 was able to vaguely recall his childhood best friend until the thirty fifth sequential photo. In another, D-67312 was unable to recall any information about his mother after seven photos featuring her. + Show Excerpt from Experiment Log 1223-57 <Begin Log> Foreword: Subject D-67394 is told that SCP-1223 will display photos from his life using an experimental device monitoring his brain via electrodes. Subject is instructed to view each image and describe his feelings into the microphone to help calibrate the device. Upon activation, SCP-1223 displays ███ consecutive photos of a young woman and two toddlers in various locations. Up until this point, SCP-1223 had only displayed 6 consecutive images of the same individual(s). Displayed image 16: The woman is seated in a recliner, with both toddlers lying in her lap. All three are smiling at the camera. Caption: Everyone’s getting cozy with mommy! Subject D-67394 (Laughs) Oh, man. I forgot all about that chair. [REDACTED] and [REDACTED] used to love climbing over everyone who sat there. Displayed image 33: The woman is standing on the back porch of a trailer, wearing shorts and a tank top. Both children are wearing red and blue face paint and carrying sparklers. Dark bruises can be seen on the woman’s thighs and upper arms. Caption: What an ~EXPLOSIVE~ Independence Day! Subject D-67394 I remember that Fourth of July! [REDACTED] didn’t think the kids were old enough to play with sparklers, yet. They loved them! [REDACTED] got scared of hers and dropped it after it burned too close to her hand, but she was a little daredevil. She stole her brother’s ten minutes later! Displayed image 78: The two children seated at a dinner table with a large cake in front of them. The children are wearing matching pink and blue hats with the number four written on them in glitter. The woman is kneeling between the two children’s seats while they smear cake on her face. Caption: They thought mommy was the SWEETEST! Subject D-67394 Oh, god! I nearly peed my pants when they did that! [REDACTED] bent down to cut the cake, and the kids just grabbed handfuls and went at her with it! I couldn’t believe how smart they were to pull that off at the same time like that! Displayed image 126: A point-of-view shot inside a small living room of the woman being grabbed by the throat. She displays multiple severe bruises around her mouth, eyes and forehead. One of the children is seen lying on the floor behind the woman, hiding his face. Caption: You told that BITCH to watch her mouth. Subject D-67394: What? What the fuck is this? Who the fuck did that to her? Hey! What the hell is with this thing? Why is it— Displayed image 127: The woman is lying on the floor of the room pictured in image 126. She displays massive facial trauma consistent with a close-range gunshot wound. Caption: She won’t run that pretty mouth any more! Subject D-67394 Oh, Jesus. I’m gonna be sick. Oh, Jesus. Are these fake? Where did you get this? Displayed image 128: A second point-of-view shot. Both children are seen cowering in a corner. A shotgun barrel is protruding from the bottom-right corner of the image. Caption: Little pitchers have big ears! Subject D-67394 Oh, no. No, no. You made these up, right? Hey, where are [REDACTED]? Hey! Man, I’m talking to you! I want to know where the fuck my wife and kids are, right now! (Subject reacted violently at this point. Subject was restrained with lidlocks and testing resumed.) *Displayed image ███: A repeat of image 16. Subject D-67394 (Subject had not spoken for over ██ images.) Huh, cute kids. Who’s she? <End Log> Closing Statement: Subject D-67394 was incarcerated for the first degree murder of his wife and children. Recommend further testing using D-class convicted of crimes against friends or loved ones to test potential sapience of SCP-1223. « SCP-1222 \| SCP-1223 \| SCP-1224 » ‡ Licensing / Citation Cite this page as: "SCP-1223" by Wildt, from the SCP Wiki. Source: https://scpwiki.com/ scp-1223. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxappliancecognitohazardelectronicmemory- affectingobservationalsafescpvisual page revision: 13, last edited: 21 Oct 2022 08:18 Edit Rate (+183) Tags Discuss (26) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1224 rating: +166+–x Item #: SCP-1224 Object Class: Safe Special Containment Procedures: All acquired instances of SCP-1224 must be contained in separate blast chambers in the Hazardous Materials Wing of Site 37, with the exception of any acquired instruction booklets, which are to be scanned into the onsite secure database and subsequently destroyed. Description: SCP-1224 is a set of 17 instances of "Dr. Wondertainment's Super Science™ Li'l Chemist Kit™!". All kits are contained in metal boxes measuring 35.5 cm x 65 cm x 25.25 cm. The boxes are composed of a metallic alloy containing lead, aluminum and iron. The hinged lid of each kit is fully covered with a unique photographic sticker displaying an ethnically diverse group of 2-4 children playing with the contents of the kit. In the lower right corner of each sticker is the following warning label: Dr. Wondertainment's Super Science Sets™! are intended for children ages 7-12. Any experiments using Dr. Wondertainment's Super Science Sets™! should be performed only with adult supervision. All instructions should be followed exactly for best results. SCP-1224 kits each contain a test tube rack composed of the same alloy as the box; 5 test tubes and an Erlenmeyer flask, all made of borosilicate glass; a small heating element; a borosilicate glass stirring rod; a glass and rubber pipette; 50 brown, opaque glass bottles with paper labels; and an instruction booklet. The bottles contain a wide variety of chemical compounds, including hydrofluoric acid, sodium hydroxide, colloidal silver, liquid mercury (labeled "Quicksilver"), small granules of uranium yellowcake, and several unknown compounds labeled "Super Reagent!", "Super Catalyst!" and "Super Accelerator!". SCP-1224 instruction booklets are 62 pages long and consist of 1- or 2-page instructions on how to conduct different experiments or create different substances or products. These range from simple compounds such as oobleck and vinegar-and-baking soda mixtures to more complex and unusual products such as "smoke bomb" pellets capable of producing approximately 1 km³ of non-toxic purple smoke, "glow in the dark" paint capable of emitting light at 5000 lux, and "vanishing cream" capable of temporarily redirecting light around subjects it is applied to, rendering them invisible for up to 5 minutes before losing efficacy. All of the more complex products require some combination of the 3 unidentified compounds. Attempts to replicate the experiments without using these compounds result in inert substances. The back page of each booklet contains a re-order form for the chemical compounds. Re-order requests have consistently been filled within 4-6 weeks, although the supplied mailing address does not exist. At the bottom of the re-order form is an advertisement to purchase "Dr. Wondertainment's Super Science™ Li'l Physicist Kit™", "Dr. Wondertainment's Super Science™ Li'l Geologist Kit™!", "Dr. Wondertainment's Super Science™ Li'l Geneticist Kit™!", as well as an advertisement for a television program entitled "Professor Abnormal's Science Lab". Attempts to order these kits using the re- order form have consistently resulted in form letters stating that the kits are available in retail outlets only. « SCP-1223 \| SCP-1224 \| SCP-1225 » ‡ Licensing / Citation Cite this page as: "SCP-1224" by Drewbear, from the SCP Wiki. Source: https://scpwiki.com/ scp-1224. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxchemicaldr-wondertainmentsafescptoy page revision: 15, last edited: 21 Oct 2022 07:58 Edit Rate (+166) Tags Discuss (42) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1225 rating: +97+–x Item #: SCP-1225 Object Class: Safe Special Containment Procedures: SCP-1225 is kept within its original packing, including styrofoam padding, in an isolated room measuring 15 m x 15 m x 15 m at Site 37. SCP-1225 is kept in a locked stainless steel box on a concrete pedestal that is protected from the elements, in a 25 m x 25 m roofless containment area open to the air in at least a 180 degree arc. Unless part of an experiment, no sealed or closed containers are allowed within the containment area, including pockets in clothing and end-caps on pens. Personnel should spend no more than 60 minutes per 24 hour period within the containment area. Description: SCP-1225 is a spindle-shaped glass ornament with a small loop at the top allowing it to be hung from a hook. When hung on a tree, bush or other "woody" plant, it initiates a process of accelerated decay and aging in any closed containers within 4 meters of it. The contents of these containers will change so as to reflect the signs of typical wear-and-tear that the object would acquire over the course of several years. Textiles, clothing and stuffed plush items become faded and threadbare, often with ripped seams and missing or broken fasteners. Solid-state metal, plastic or glass objects will display chips, cracks, scratches, and heavy corrosion similar to acid burns. Electronics display both hardware and software problems sufficient to cause fatal shutdowns within a few minutes of use. Foodstuffs will become stale or moldy. Living organisms do not die, but display health problems consistent with age as well as extended malnourishment, neglect or abuse. The decay process is rapid, with affected objects displaying approximately 1 year's worth of aging within the first 24 hours of exposure. However, the rate of decay slows over time and asymptotically approaches a maximum of approximately 10 years' worth of aging over the course of 3 weeks. Addendum 1225-D: Study of SCP-1225's pre-containment circumstances, as well as experimentation regarding the aging effects of long-term exposure to SCP-1225, indicate that SCP-1225 has a secondary effect. Any individuals that spend more than 4 hours per 24 hour period within 10-12 meters of SCP-1225 begin to display increased levels of aggression, anger and irritability, decreased patience and frustration tolerance, and exaggeration of negative or annoying personal traits such as over-eating, alcohol consumption, snoring and unpleasant body odor. This effect persists even when the affected individuals are no longer within range of SCP-1225, but gradually fades over the course of 8 days. This increase in aggravating factors typically results in heightened levels of interpersonal conflict, most commonly expressed by severe verbal or physical fights. When more than one individual affected by SCP-1225 interact with each other, the effects are much more severe and escalate much faster. In 27.5% of cases, this results in serious injuries or fatalities. Addendum 1225-H: Due to a statistically abnormal amount of equipment failure, structural decay and interpersonal conflicts requiring administrative action at Site 37, more in-depth studies were performed on SCP-1225. The current prevailing theory is that SCP-1225 still operates even when not placed on a plant, but much slower and less intensely. It appears to treat enclosed structures or buildings containing it as if they were containers placed beneath it and will affect them as well. Whether or not the containing structure includes a roof, trellis or other overhead cover appears to most strongly determine whether or not SCP-1225 will affect the structure. The acquisition of D-Class personnel from SCP-784 is currently under consideration due to the fact that these personnel are less prone to equipment failures caused by SCP-1225. Further research is required in order to determine the exact nature of this effect. Containment protocols have been updated. « SCP-1224 \| SCP-1225 \| SCP-1226 » ‡ Licensing / Citation Cite this page as: "SCP-1225" by Drewbear, from the SCP Wiki. Source: https://scpwiki.com/ scp-1225. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxartifactbleakchristmasentropicsafescptransfiguration page revision: 25, last edited: 13 Oct 2024 16:06 Edit Rate (+97) Tags Discuss (25) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1226 rating: +106+–x Item #: SCP-1226 Object Class: Safe Special Containment Procedures: SCP-1226 is to be hung on the wall of a standard containment chamber, and access restricted to testing personnel. SCP-1226 may be safely observed remotely or piecemeal; its anomalous properties manifest only when it is viewed in person and in its entirety. A 6 cm x 6 cm square of opaque black plastic has been positioned in the upper left corner of SCP-1226, to be removed for testing purposes. Only D-class personnel are permitted to view SCP-1226 uncovered. Special security precautions are to be taken when exposing subjects to SCP-1226, as post- exposure subjects exhibit heightened aggression, endurance, and physical strength. Post-exposure subjects are to be terminated at the conclusion of testing. Description: SCP-1226 is a large oil landscape painting measuring 2 meters by 4 meters. It depicts, in great detail, the detonation of a nuclear weapon above a large city1. Photorealistic attention has been paid to every detail of the painting, from optically correct reflections on the thousands of glass shards depicted, to the accurate representation of the effects of atomic firestorm on the 3,129 human figures portrayed on the streets. SCP-1226 was originally displayed in a varnished oaken frame and accompanied by a freestanding informational plaque2. For full text of the plaque, see Addendum 1226-02. When a subject views the whole of SCP-1226 in person, it causes an immediate mental and physical change in the viewer. A significant increase in physical size and overall musculature is accompanied by a pronounced curvature of the spine, forcing a hunched, simian posture. The skull is radically reshaped, the forehead sloping and jaw protruding. This results in a marked reduction of total brain mass and an increase in cranial pressure, with a significant reduction in cerebral volume. These changes occur over the space of about 40 seconds, and are evidently extremely painful. Post-exposure subjects exhibit a massive loss of mental capacity consistent with the reduction in brain mass. Subjects are capable of only rudimentary guttural vocalizations and simple gesturing by way of communication, and are concerned only with feeding, copulating, and other basic instinctual behaviors. Due to the intense pain and loss of mental function associated with transformation, subjects invariably enter a violent state of panic. Initial descriptions of affected subjects as "cavemen" have been proven inaccurate. Autopsies and paleontological analysis have revealed marked dissimilarities between known human ancestors and affected subjects. Currently favored theories propose that subjects are altered into either a hitherto-undiscovered prehistoric hominid, or a popularly-perceived "caveman" archetype. All re-education and rehabilitation efforts to date have failed due to the radical simplification of subject's brain structures. Addendum 1226-01: Acquisition Log. SCP-1226 was acquired on ███ ██, ████, following its unveiling at [DATA REDACTED] Gallery in [DATA REDACTED]. The unveiling event was heavily promoted as featuring the latest work of ███████ ███████, and was attended by many well-known members of the global artistic community. The unveiling event exposed ███ individuals to the anomalous effects of SCP-1226. Those gallery patrons and employees not exposed were killed by exposed subjects over the next half hour, either through bludgeoning, cannibalism, ██████ ███████████, or some combination thereof. 911 calls and police reports were intercepted by MTF Upsilon-23 ("Art Critics"), affected subjects captured or eliminated, and amnestics administered to witnesses and first responders. SCP-1226's anomalous effects were confirmed on-site by MTF Upsilon-23, and SCP-1226 was taken into containment. Addendum 1226-02: Text of Informational Plaque. The inevitable conclusion of the modern age is in self-destruction! The post- modern era will be like the pre-modern era, the new will be like the old, there will be shiny chrome primitivism for everyone, and we'll all finally be cool. ~███████ ███████3 Footnotes 1. The skyline of the city depicted in SCP-1226 does not conform to that of any currently extant urban center. 2. Neither frame nor plaque have exhibited anomalous properties, and may be viewed upon request. 3. Mr. ███████ ███████, noted post-modernist painter, professed no knowledge of an exhibition at [DATA REDACTED] featuring his work. Furthermore, SCP-1226 is highly atypical of his artwork. « SCP-1225 \| SCP-1226 \| SCP-1227 » ‡ Licensing / Citation Cite this page as: "SCP-1226" by NineAndNinetyHours, from the SCP Wiki. Source: https:// scpwiki.com/scp-1226. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxare-we-cool-yetartisticcognitohazardsafescptransfigurationvisual page revision: 29, last edited: 21 Oct 2022 08:25 Edit Rate (+106) Tags Discuss (69) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1227 rating: +172+–x Item #: SCP-1227 Object Class: Euclid Special Containment Procedures: SCP-1227 is to be kept in a concrete chamber 30m X 30m X 5m, only accessible through a double airlock system. All researchers wishing to investigate SCP-1227 must wear regulation biohazard suits with an enclosed onboard oxygen supply. The chamber contains a 20m-wide red circle painted on the floor, henceforth referred to as the ‘safe zone’. Before Airlock D is opened, SCP-1227 will be instructed to move to the center of the safe zone. Throughout our interactions with SCP-1227, it has been noted that SCP-1227 is relatively docile and will usually submit to these requests; however, its co-operation should not be taken for granted and Airlock D will not be opened until it is fully within the safe zone. Due to SCP-1227's passive nature and severely limited mobility, safety outside the safe zone is usually assured. Under no circumstances should any personnel or other biological material enter the safe zone, or engage in physical contact with SCP-1227. Description: It is believed that SCP-1227 was formerly Yuri Seryogin, a political prisoner of the USSR, arrested in 1957 for pro-democracy leanings. Parts of SCP-1227’s extended body have also been positively identified. Scars on the face of SCP-1227-E have been matched to photographs of Aleksey █████, a known associate of SCP-1227. SCP-1227-B is believed to be the trunk and head of SCP-1227’s wife, by his own admission. The remaining parts of SCP-1227’s mass remain unidentified. Documents obtained by the Foundation after the collapse of the Soviet Union have revealed that SCP-1227 is the indirect result of a Russian social experiment conducted by ███ ████████ during the winter of 1960. During this study, six political prisoners, including Yuri Seryogin, Aleksey, and Yuri’s wife, were led into the depths of an unidentified cave by the KGB as an experiment into group dynamics under severe stress. The prisoners were provided with a limited food supply and water but no light sources. After 5 days of relatively normal social functioning, the group descended into two warring factions, which eventually led to three further days of incoherent screaming, muttering, torture, rape and one forced abortion. On the final day of the experiment, the KGB researchers recorded some 'disturbing' sounds over the concealed microphones, including screaming, pleading, vomiting and [REDACTED]. The caving team sent to observe the status of the prisoners discovered a large amount of decomposing human tissue in a liquefied state, with SCP-1227 having formed in the center of it, apparently in good physical and mental health, and failing to notice anything amiss with its new situation. The Foundation was notified and SCP-1227 was extracted from the USSR by Mobile Task Force Epsilon-█. SCP-1227 appears to be a male figure bonded to the heavily disfigured bodies of nine people by a red web-like mass which has been confirmed to be SCP-1227’s own muscles, and tube-like extrusions confirmed to be heavily developed extrusions of SCP-1227's own respiratory and digestive tracts. Experimentation has demonstrated that physical contact with SCP-1227 will lead to this bonding process being initiated. Firstly, the victim will fall into a coma-like state, whatever part of the body that contacted the creature becoming fused there. Then, SCP-1227 will permanently bond the victim’s body to its own by extruding its own blood vessels and nerves into the victim’s body. Finally, SCP-1227 will take control of one or more of the victim’s vital systems by assimilating that system into its own with its own nerves/blood vessels/intestines. Any part of the victim not associated with this system will lose blood flow and eventually drop off. SCP-1227 will feed any limbs that drop off into the beginning of its extended digestive tract, a hole in the chest of SCP-1227-D. The heart is always kept alive to pump blood around the vastly extended body. Although SCP-1227 does not seem to harbor ill will towards human beings to any major extent, it wields no control over this ability, hence the 'safe-zone' protocol. Experimental data suggest that this combination of multiple organ systems has greatly increased SCP-1227's biological efficiency, allowing it to survive on extremely limited resources. One observed effect is that SCP-1227's urinary tract is now three times longer than normal and so efficient that SCP-1227-F is now observed to deposit roughly 60g of concentrated urine every three years, which analysis has demonstrated to be 99.9% pure urea. SCP-1227-A and SCP-1227-C have had their respiratory tracts connected into SCP-1227's lungs, meaning that he can process air so effectively that SCP-1227 can survive for a duration of up to six months in a complete vacuum, at the cost of falling into a hibernation-like state. A full breakdown of SCP-1227’s bodily systems follows: (Unless stated otherwise, all victims are USSR political prisoners) SCP-1227-A: Unidentified male. Connected to SCP-1227 by 1.5 meters of esophagus/ blood vessels. Legs have been removed. Arms still mobile, used to propel SCP-1227’s mass. SCP-1227-B: Unidentified female. Connected to SCP-1227's back by extruded muscle. Only trunk and head remain, all other limbs removed. Her womb has [DATA REDACTED]. Pupils will contract in response to high intensity light sources. SCP-1227-C: Unidentified male. Connected to SCP-1227 by 0.8 meters of esophagus/ blood vessels. All limbs have been removed. Mouth will occasionally gape widely, for unknown reasons. SCP-1227-D: KGB researcher ██████. Connected to SCP-1227 by 0.5 meters of intestines. Head and limbs have been removed. Serves as beginning of digestive tract; all food is placed directly into the stomach via hole in the chest. SCP-1227-E: Aleksey █████. Connected to SCP-1227 by extruded muscle. Only the head, trunk and legs remain, used only to help mobilize SCP-1227. SCP-1227-F: Unidentified male. Connected to SCP-1227-G by 2 meters of urinary tract. Only the trunk and right arm remain. Used to process urine and to mobilize SCP-1227. SCP-1227-G: Unidentified male KGB researcher. Connected to SCP-1227 by 3 meters of digestive tract. Only trunk and right leg remain. Serves as the end of the digestive system. SCP-1227-H: Foundation male D-class personnel D-███-██. Connected to SCP-1227 by ██████████ as well as extended brain stem. Only the head and heart remain. SCP-1227-I: Foundation test canine. Connected to SCP-1227 by 5 meters of extruded nervous system. Only head and front legs remain. SCP-1227 claims it is a ‘precaution’ for ‘self-defense’. It will often crawl to the limit of its connection to bark and whine at researchers. Close observation has revealed that it is outside SCP-1227’s control. I really wish we hadn’t tested if the effect also works on animals, but now I expect you to honor ‘safe-zone’ protocol more than ever, until we find a way to amputate the damn thing. O5-█. Despite the changes SCP-1227 has undergone, SCP-1227 still possesses human intelligence and reasoning. SCP-1227 has been successfully taught English to a sufficiently advanced degree. Psychoanalysis showed no signs of cognitive defects, or disorder of thought patterns and processing. SCP-1227 is permitted books and other entertainment at Lead Researcher Sarah Townsend’s discretion, as well as daily visits from ‘friends’ selected for him by the research staff. SCP-1227 appears to have a normal level of social functioning, and during these visits enjoys hearing stories or news about the outside world. However, it has become apparent that SCP-1227 harbours well- developed delusions into its current state of being, often claiming that SCP-1227 A-H are ‘children’ playing peacefully nearby, as well as repeatedly claiming SCP-1227-D’s stomach is an ‘oven’. Further interviews have shown that SCP-1227 believes itself to be in a normal family setting, with a wife and several children. SCP-1227 appears to regard containment and constant experimentation as a normal part of family life, never questioning orders or requests in order to preserve its own illusions. Rational-Emotive Therapy has been applied, without success. On one notable occasion (22/09/██), SCP-1227 complained of feeling ‘hungry’. Minutes later he grabbed an unwary D-Class personnel and mostly tore him apart, feeding the carcass into SCP-1227-D. Afterwards he bonded what remained to his biomass, which would later become SCP-1227-H. He appeared to be under the impression that he was ‘preparing a feast’ for his ‘family’ the whole time. It is currently unclear if these delusions are symptoms of a disorder such as schizophrenia, or if SCP-1227 is attempting to escape the horror of its current situation by creating a full intrapsychic world where it feels safe; it should be noted that SCP-1227 often claims its childhood was the happiest time of its life, and perhaps this is why its delusions center around themes such as childhood and family. One major breakthrough came when SCP-1227 admitted that the serious puncture wounds to both its eyes were self-inflicted, possibly in an attempt to escape the sight of its own vastly mutated body. All attempts at therapy have failed; the subject appears to be in a well-developed denial system, often becoming aggressive and frustrated when therapists tell him they cannot see his seven playing children, or his devoted wife. All attempts to get SCP-1227 to elaborate on the events inside the cave, or how he acquired these new abilities, are typically met with sudden staring, drawing its body parts around it, and refusing to speak for 2-4 months. « SCP-1226 \| SCP-1227 \| SCP-1228 » ‡ Licensing / Citation Cite this page as: "SCP-1227" by AstronautJoe, from the SCP Wiki. Source: https:// scpwiki.com/scp-1227. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxalivecontagioneuclidhumanoidsapientscpself-replicatingtransfiguration page revision: 35, last edited: 21 Oct 2022 08:16 Edit Rate (+172) Tags Discuss (57) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1228 rating: +176+–x Item #: SCP-1228 Object Class: Euclid Special Containment Procedures: Foundation Agents are to infiltrate all major Internet service providers to ensure civilian access to SCP-1228 is blocked. Any personnel accessing SCP-1228 for testing purposes is to be accompanied by at least one Researcher, and must submit to mandatory psychological evaluation afterwards. (Access to SCP-1228 outside of testing purposes is now strictly forbidden. See Incident 1228-A for further details.) Description: SCP-1228 is a website with the domain ████████████.com. Any software used to monitor Internet connections crashes when applied to connections to SCP-1228, so its IP address is unknown. The domain is not registered by anyone, and when usually accessed gives the normal "DNS lookup failed" error. However, if viewed by an individual with a history of creative aspirations, SCP-1228 will appear as the page of the viewer’s “Official Fan Club.” Although the site’s contents vary from individual to individual, a few pages appear consistently. Wiki: Extensive documentation of the subject’s work. Subjects typically claim that the nonexistent titles listed are “something they’ve always wanted to do.” News: Reports of nonexistent events in the subject’s life. Events reported are invariably of a positive nature, such as the subject winning a major award for their work. Interviews with the subject are often listed here as well, with the subject usually mentioning in the interview that they’re glad they chose to pursue their passion rather than their career path in real life. Forums: Discussion of the subject and their work. Posters’ comments are all unanimously positive, praising everything the subject has produced. In order to gather as much information on SCP-1228 as possible, the Foundation strongly encourages test subjects to post on the forums themselves. Store: A store exists for the purchase of merchandise pertaining to the subject's work, such as T-shirts, posters, and figurines. Within ██ hours of making a purchase, an unmarked package will appear at the subject’s address containing the product(s) in question. Attempts to trace the origin of the packages and their products have proven unsuccessful. After viewing SCP-1228, test subjects will report feelings of depression, with thirty percent attempting suicide shortly afterwards. Incident 1228-A: On 09/17/20██, Dr. █████████, the current Researcher presiding over SCP-1228, was reported missing. An aspiring writer in his youth, █████████ had taken to browsing SCP-1228 obsessively. Investigation of his offices revealed a log of private messages with a forum poster named “Ellen.” • • • • + Conversation Log Ellen: I can’t believe it! It’s really you! You have no idea how long I’ve dreamed of talking with you! :) Dr. █████████: Aww, thanks. It’s always an honor talking to a fan. Ellen: I’ve read every single one of your books. I especially liked the one about the guy who goes crazy at sea. I cried like a baby at the end! Dr. █████████: Really? That’s what I’ve wanted to do ever since I was a kid, really. Write something that makes people emotional. Ellen: You make me REAL emotional, if you know what I mean. You wouldn’t be interested in meeting up sometime, would you? Dr. █████████: I’d love to. Where at? Ellen: I live at [REDACTED]. See you then! ;) An Agent was dispatched to the address, revealing an abandoned two-story house. Dr. █████████'s current whereabouts remain unknown. « SCP-1227 \| SCP-1228 \| SCP-1229 » ‡ Licensing / Citation Cite this page as: "SCP-1228" by Ryan Mahan, from the SCP Wiki. Source: https:// scpwiki.com/scp-1228. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxcomputerdocumenteuclidonlinescptelepathic page revision: 15, last edited: 21 Oct 2022 09:12 Edit Rate (+176) Tags Discuss (51) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ PLACEHOLDER this is a staff placeholder page. please refer to this page for further information. admin page revision: 1, last edited: 15 Jan 2025 03:18 Edit Rate (-4) Tags Discuss (0) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-123 rating: +400+–x Item #: SCP-123 Object Class: Euclid Special Containment Procedures: SCP-123 is to be held in a secured facility and is to be securely fastened to the top of a sturdy table by use of straps, chains, a net, or similar device. Absolutely no hooks shall be fastened to the device. The object and table should be centrally located in a room no smaller than 5 m x 5 m x 5 m. No sensitive measuring devices should be used within 100 meters of SCP-123, as their measurements will be noticeably affected. More significantly, absolutely no objects should be inserted into SCP-123 except under experimental conditions. Transfer of SCP-123 shall be made with care, and effort made to prevent the object from being shaken or jerked with notable force. SCP-123 shall not, under any circumstances, be transported over large bodies of water by any method. No personnel below Level 2 must be allowed in the containment chamber with SCP-123. Any person interacting with the object should wear tight-fitting clothing that has absolutely no straps, laces, or other dangling components. Persons with long hair shall be required to tie their hair back or wear a hairnet. Description: Object is a gray geodesic sphere 65 cm in diameter consisting of sixty triangles. The areas between these triangles are empty, allowing the center of the sphere to be seen. The material the sphere is composed of is unknown, and upon the recommendation of Dr. █████, research into the material composition shall be limited to visual observation until further notice. SCP-123 appears to weigh about 3.62 kg, though its actual mass is believed to be much higher. The geodesic sphere is hollow, save for the very center. At the center of SCP-123 is what appears to be a black sphere, approximately 1 mm in diameter. No light can be seen being reflected off or emitted from the black sphere. The core also appears to exhibit significant gravitational force, which massively increases within the confines of the outer geodesic sphere. This gravitational force can be measured using sensitive instruments several dozen meters away. Within approximately three meters, the gravitational pull is apparent to any observer, with dangling objects beginning to be pulled towards the sphere. At the surface of the outer sphere, the gravitational pull doubles the weight of any object placed onto the structure. The inner sphere’s qualities are apparent when any small object is inserted within the outer sphere. Any such object quickly accelerates into the object and disappears. Any liquid poured into the object also is sucked into the central sphere. Analysis has shown that light that nears the black sphere is curved towards the center. The amount of gravity exhibited by the inner sphere at its surface suggests that its mass is approximately 1029 kg, though the obvious gravity reducing effect within the outer sphere means that its actual mass may actually far exceed even that. Note that such a mass would ordinarily imply a Schwarzschild radius in the order of 200 meters, way in excess of the approximate 0.5 mm actually observed, which can be considered further testament to the outer sphere's gravity dampening qualities. Gases are affected by the gravity of SCP-123, and the atmosphere pressure at its surface has been measured at 205 kPa. However, gases are unable to penetrate the area between the triangles of the outer geodesic sphere. The reason for this is currently unknown, and is currently being studied. It should be noted that the outer sphere and inner sphere appear to act as one – whenever the outer sphere is moved, the inner sphere follows. Further research is suggested into the nature of this relationship. Addendum [SCP-123a]: SCP-123 has been suggested as a disposal unit. The researcher currently in charge of SCP-123, Dr █████, is concerned about the structural integrity of the geodesic sphere. All requests for disposal must go through Dr █████, or request a formal hearing with Level 4 personnel. Until further notice, all interaction with SCP-123 is to be restricted to experimentation. Command personnel agree that further research is needed to understand the durability of the outer sphere. « SCP-122 \| SCP-123 \| SCP-124 » ‡ Licensing / Citation Cite this page as: "SCP-123" by sloppyjoes7, from the SCP Wiki. Source: https://scpwiki.com/ scp-123. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxeuclidgravityscpspatialsphere page revision: 32, last edited: 03 Jan 2023 15:31 Edit Rate (+400) Tags Discuss (49) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1230 rating: +1632+–x SCP-1230 Item #: SCP-1230 Object Class: Safe Special Containment Procedures: SCP-1230 is to be kept in a secure storage locker at Site-12. Access requires minimum Clearance 2 with authorization and supervision by Clearance 3 research and security staff respectively. Supervising personnel are not to view SCP-1230's contents. Personnel accessing SCP-1230 are required to submit written accounts of dreams experienced within 48 hours of access. (See Addendum-1230-A) SCP-1230 has been relocated to a secure storage locker behind the desk of Site-12's main library. Access is available to Clearance 2 personnel deemed to be in satisfactory psychological condition by site psychiatric staff. Personnel accessing SCP-1230 must submit written accounts of their dreams within 48 hours of access and submit to follow-up psychological examination. Description: SCP-1230 is an unlabeled, green hardcover book with no apparent exceptional qualities. When SCP-1230 is opened, it displays the phrase “A hero is born” on the first page viewed, while all other pages will be blank, "resetting" once the book is closed. This has no obvious effects at first, but upon falling asleep, the reader will dream of a fantasy world where they are the protagonist of a troubled land. Dreamers are completely aware and all senses work just as well as when awake. Results vary depending on the imagination of the reader and are mostly attuned to fantasies of adventure that the reader would enjoy. In the mind of the reader, these dreams have been documented to last anywhere from 45 seconds (see Experiment 1230-3) to 200 years (see Experiment 1230-5) but in reality, the reader will usually never be asleep longer than they would normally. Upon awaking, the reader is able to remember every aspect of their dream in detail. In SCP-1230-induced dreams, there is always a character called the “Book Keeper” (SCP-1230-1) appearing as a bearded man in a green cloak who claims to be the personification of SCP-1230 himself. SCP-1230-1 has been reported to be very amicable and helpful towards dreamers. It has stated that it enjoys creating these “fantasy-scapes” and always tries to shape them in such a way that the dreamer garners the most entertainment out of it. It has expressed sorrow when the dream comes to an end and asks the dreamer to “please visit again soon”. Discovery: In a small bookstore located [DATA EXPUNGED] the shopkeeper had no recollection of owning the unlabeled book but attempted to sell a story to local newspapers about a “magical dream book”. The Foundation was able to dispel the story as a hoax and SCP-1230 was confiscated. Experiment-1230-01: Dr. F███████, in an attempt to test its effective range, opened SCP-1230 and boarded a flight to his hometown of [REDACTED] where he spent the night at a hotel. Upon his return, Dr. F███████ reported that SCP-1230-1 appeared in his dreams and explained that once you read ‘A hero is born’, the dream is immediately implanted in your subconscious, after which SCP-1230-1 is able to manipulate it remotely. Dr. F███████ expressed his appreciation for SCP-1230-1’s cooperation. Experiment-1230-02: A camera was set-up above SCP-1230 and, using a mechanical “arm”, the book was opened. All pages were revealed to be blank. It seems SCP-1230 is only effective when opened by beings that are able to have dreams. SCP-1230-1 explained to a subsequent dreamer that it is actually only able to affect beings “with an imagination” and that most creatures such as animals would not be affected. Experiment-1230-03: One (1) D-class was instructed to open the book and (after much reassurance that his experiences would only be dreams) ordered to immediately find a way to kill himself in the dream. The subject was asleep for merely 45 seconds before he awoke with a start in a nervous sweat. He reported being at the summit of a volcano called “The Ashen Spire” on a quest for “Caladius, the Blessed Blade”. When asked how the subject knew the names, he stated, “It’s like I knew them all along”. He apparently leapt into the volcano and “felt an intense heat” before awakening. D-class requested permission to "give it another go". Request was denied. Experiment-1230-04: One (1) D-class was instructed to open the book and attempt to non-fatally injure himself in his dream. After 6 hours, the D-class awoke and reported that he was able to feel a “numbed” sort of pain where it was never so intense as to be unbearable. He also reported meeting an elderly, cloaked man who asked him why he was harming himself, but thanked him for not immediately killing himself “like that other rude fellow”. Experiment-1230-05: Professor B████ filed a request for access to SCP-1230 and was quickly permitted, given his Level 4 clearance. Staff members recalled that Professor B████ was almost “visibly shaking with excitement” and some reported that Professor B████ was an avid fan of tabletop and role-playing games. Surveillance shows that Professor B████ opened the book, read the phrase, sat down beside the desk and promptly fell asleep. Staff members were alarmed when Professor B████ did not awake after 15 hours and alerted security. The on-site medical staff were able to confirm that Professor B████ was still alive and in good health. After approximately 24 hours since falling asleep, Professor B████ began to move, reported to have "slowly raised his head and looked around the room, appearing deeply confused". Security entered the room to ensure he was alright, to which he replied, “Where am I?”. He was sent to Medical where staff explained where and who he was. Several minutes later, Professor B████ appeared to have regained his memory and excused himself to the restroom. When 15 minutes passed and Professor B████ had not exited, a nurse entered to find he had hanged himself with his belt. A scribbled message on the wall revealed his last words: “I can’t go back to this”. Dr. F███████ went to ask SCP-1230-1 what had happened, but upon opening SCP-1230, all its pages were soaking wet with the same message on every page: “I’m so sorry. I never intended for this to happen. I just wanted to make people happy.” repeated over and over. SCP-1230 remained in this state for three weeks and its desk had to be wiped dry biweekly. In an attempt to communicate, Dr. F███████ placed a sticky note inside SCP-1230 with the statement, “I’d like to talk to you, if that’s alright”. The next morning, Dr. F███████ filed a report about a dream he had concerning SCP-1230-1. + Report-1230-14 Upon falling asleep last night, I dreamt I was in a dark void. There was a streetlamp and underneath it was SCP-1230-1 sitting in a puddle. His cloak was visibly soaked and he was sobbing profusely. I remember our conversation: Dr. F███████: Book Keeper? Is that you? My god, man, where are we? Book Keeper: (between sobs) I… couldn’t think of anything to make for a landscape. Dr. F███████: Book Keeper… what happened that day? Why did Professor B████ kill himself? We have to know your side of the story. Book Keeper: (wiping his eyes) He had such an active imagination! I was able to create a vast and beautiful universe for him and it was obvious that he had wanted a life like that for so long. He conquered foul beasts and rescued princesses… He built kingdoms and even raised a family… but he never wanted to leave. He delved so far into his fantasy world that I soon realized he preferred his dream over the real world. I reminded him that this was all merely an illusion, but he wouldn’t listen to me. He stated that if he was ever forced to leave, he would immediately end his life. I tried to keep him happy for as long as I could… Dr. F███████: …Book Keeper… how long was the dream from his point of view? Book Keeper: …200 years, Doctor. I did my best but I could only hold onto him for 200 years. As sweet as dreams may be, eventually we all have to wake up. I awoke almost immediately after. I can’t believe he spent 200 years in his dream. I’m astounded by his foolishness but it’s such a shame to have lost a brilliant mind to his own delusions. Shortly after the report was filed, surveillance showed Dr. F███████ slipping another small paper into SCP-1230. A few days later, SCP-1230 began showing its usual “A hero is born” greeting once again. When asked what the note said, Dr. F███████ declined to give detailed comment, simply stating that he "just gave it some friendly advice". Addendum-1230-A: During initial testing, SCP-1230-1 asked dreaming personnel if it could be relocated to an area with many books (preferably fiction) so that it could think of even better ways to construct its “fantasy-scapes”. After numerous experiments were performed to ensure that SCP-1230 posed no threat, the request was accepted and SCP-1230 has been relocated to Site-12's library. « SCP-1229 \| SCP-1230 \| SCP-1231 » ‡ Licensing / Citation Cite this page as: "SCP-1230" by MrPixel, from the SCP Wiki. Source: https://scpwiki.com/ scp-1230. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. Filename: new1230.png Author: MrPixel License: CC BY-SA 3.0 Source Link: SCP Foundation Wiki _cc_licenseboxdocumentillustratedmemory-affectingsafescpsleep page revision: 51, last edited: 04 Oct 2024 09:38 Edit Rate (+1632) Tags Discuss (178) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1231 rating: +558+–x Item #: SCP-1231 Object Class: Euclid Special Containment Procedures: SCP-1231 is contained in an unlit vault, dimensions 0.6 m x 0.8 m x 0.2 m, located in Site-20. Guards are posted outside of the vault, denying access to all personnel without direct and confirmed Level 5 authorization. A video camera is installed in the vault, taking a live feed of SCP-1231.1 This video is in turn fed through a specially designed program, displaying only the number of thumbnails and if there is a significant error. Access to the raw feed is strictly prohibited. A mouse is located near the terminal, but remains disconnected under normal circumstances. New personnel assigned to SCP-1231 must be hand-picked specifically for testing purposes. However, testing is currently suspended. Description: SCP-1231 is a black Amiga A1200 computer manufactured by Commodore International, missing all other identifying marks including its serial number. It runs independently despite the lack of a power source. SCP-1231 does not function as an Amiga A1200 should and generally only displays a screen full of thumbnails, named the "Primary Screen." SCP-1231 cannot be shifted from its current settings, and as of yet no other programs have been discovered on the computer. External attachments, such as mice and keyboards work normally. The Primary Screen contains 9114 thumbnails, organized in rows of twenty (20) ascending numerically by age. A scrollbar is located on the right side of the screen.2 The thumbnails display extremely low-resolution moving pictures. There is no audio Most videos do not contain audio; however, despite the lack of speakers on SCP-1231, low- decibel sounds can occasionally be heard. Clicking on a thumbnail causes the video displayed to increase in resolution and fill nearly the entire screen, except for a thin white bar on the top bearing the number of the thumbnail. Clicking a second time returns the screen to the Primary Screen. Although the videos vary significantly, there are consistently three subjects (known as SCP-1231-1, -2, and -3) present. SCP-1231-1 is generally a tall, middle-aged, Caucasian man. SCP-1231-2 is generally a younger, shorter, Korean woman. SCP-1231-3 generally appears as either a light-colored child approximately four years of age or a feral mid-size animal. The videos do not loop, although the same actions are performed repeatedly in the videos with incredibly minor deviations. New videos are generated when a human subject misperceives an existing video or thumbnail. The new video contains a representation of what was believed to be in the prior video. Testing has shown that only minor details (such as the color or position of an object) is sufficient for this effect to occur. Direct observation of SCP-1231 is not necessary and rudimentary knowledge of a video or thumbnail can lead to speculations that generate more videos. However, new videos can be created at a maximum rate of one per minute. Due to the virulence of its infohazardous properties, SCP-1231 is classified as a Beta-Gimmel-White infohazard. Excerpts from Document 1231-A: Thumbnail Descriptions Thumbnail 1: [DATA EXPUNGED] Thumbnail 2: The setting is the same room as Thumbnail 1. Discovered on the second test of SCP-1231. Believed to have been created after exposure to Thumbnail 1. SCP-1231-2 is scooping an unknown powder with her left hand while SCP-1231-3 is asleep in her right arm. SCP-1231-1 is not on the screen. Thumbnail 3: The setting is the same room as Thumbnail 1. Discovered on the second test of SCP-1231. Believed to have been created after exposure to Thumbnail 1. SCP-1231-2 is asleep, while SCP-1231-3 is crawling over her. SCP-1231-1's leg is present in the upper right of the screen, although the rest of his body seems to be just outside of view. Thumbnail 4: The setting is the same room as Thumbnail 1. Discovered on the second test of SCP-1231. Believed to have been created after exposure to Thumbnail 1. SCP-1231-3 is mauling the pectoralis minor of SCP-1231-2. SCP-1231-1's mutilated right leg and pelvic region is located in the upper right portion of the screen. Thumbnail 39: The setting is the same room as Thumbnail 18. Discovered on the second test of SCP-1231. Believed to have been created after exposure to Thumbnail 24. SCP-1231-1 is dislocating and relocating SCP-1231-2's shoulder with his right hand, though both are standing erect. SCP-1231-3 is asleep in the upper left of the screen. Thumbnail 902: The setting is the same room as Thumbnail 600. Discovered on the second test of SCP-1231. Believed to have been created after exposure to Thumbnail 419. SCP-1231-1 is lying on top of SCP-1231-2, smashing SCP-1231-3 on the floor. SCP-1231-2 is completely motionless. Thumbnail 1170: The setting is the same room as Thumbnail 1053. Discovered on the second test of SCP-1231. Believed to have been created after exposure to Thumbnail 1004. SCP-1231-1 and SCP-1231-2 are kneeling facing the camera, drenched in blood, crying and mouthing non- discernible words. What appears to be the mutilated corpse of SCP-1231-3 is lying in front of SCP-1231-2. A low-pitched laughter is audible throughout. Addendum-01: Due to the high level of similarity between SCP-1231 and other encountered "soultraps," it has been deemed likely that the entities SCP-1231-1, -2, and -3 are real in some capacity. In light of this, I am formally requesting that testing on this object be halted. -Researcher ████, Ethics Committee Addendum-02: Testing on SCP-1231 has been suspended indefinitely. The majority of personnel assigned to SCP-1231 will be administered a Class B amnesiac and transferred to a new project. -O5-██ What is the suffering of a few in the face of Science? Pain is all relative, as is eternity. We've done far worse. I'm sure we have. Addendum-03: Processed video feeds of SCP-1231 have shown that the number of thumbnails is increasing despite the suppression of knowledge relating to SCP-1231. Something's wrong. -Dr. ██████ Footnotes 1. Note that no external light source is necessary due to SCP-1231 providing ~20 lux. 2. More detailed analysis of the layout of the Primary Screen of SCP-1231 is located in Document 1231-B. « SCP-1230 \| SCP-1231 \| SCP-1232 » ‡ Licensing / Citation Cite this page as: "SCP-1231" by Rejekyll, from the SCP Wiki. Source: https://scpwiki.com/ scp-1231. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxautonomouscomputereuclidinfohazardloopmediascpvisual page revision: 24, last edited: 21 Oct 2022 08:07 Edit Rate (+558) Tags Discuss (81) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1232 rating: +80+–x Male instance of SCP-1232-1, second stage, formerly private V. I. Novosadov Item #: SCP-1232 Object Class: Safe Special Containment Procedures: Samples of SCP-1232 are to be kept in cryogenic storage on Bio-Research Site-21. While experimentation upon SCP-1232 is permitted, experimental proposals need to be validated by a researcher of valid 2/1232 clearance beforehand due to limited supply As of 12.03.1963, a process was devised to replicate SCP-1232 with reasonable efficiency (See Document 1232-Rho); as such, experimental proposals only require validation if it would be ordinarily required by the SCP Foundation Requisition Guidelines, sections C 1-7 and H 1-5. - Dr. Mihnea, Section Head As the time required for a majority of SCP-1232 testing greatly exceeds one month, D- class personnel involved in testing of SCP-1232 is exempt from monthly termination by default. Due to resistance of SCP-1232 to high temperatures, any items suspected of SCP-1232 contamination must be decontaminated by immersion in 1 molar NaOH solution, and subsequent heating in a gravity-displacement autoclave to 121 degrees Celsius for 30 minutes, followed by sterilization as usual. (See Document 1232-Sigma for a complete list of approved procedures where the stated is not appropriate) Personnel manipulating SCP-1232 samples are to use Level-A hazardous materials protective clothing manufactured to standards outlined in Document 1232-Sigma. As instances of SCP-1232-1 in the first stage are difficult to separate from the general population, the recommended means of identification of such is working through those related to known SCP-1232-1 instances, assuming the most common symptom progression. In this stage, the removal of reproductive organs seems to halt the progress of the condition, and the residual symptoms are susceptible to treatment by most tricyclic antidepressants. Instances of SCP-1232-1 in the second stage are essentially untreatable due to the extent of disruption to physiologic processes taking place, furthermore, even if treated, their reintroduction to society would be problematic. As such, they are to be euthanised, or left to expire on their own, and cremated. Description: SCP-1232 is the designation given to a mixture of unknown proteins capable of causing a condition designated Novosadov Syndrome. The mechanism upon which it relies is poorly understood at the moment. SCP-1232 is the designation given to a mixture of misfolded variants of [REDACTED] proteins (prions), capable of causing a condition designated Novosadov Syndrome. The precise mechanism of action is unknown - administration of isolated constituent prions, or partial mixtures to human subjects had no discernible effects, or caused conditions only weakly related to the syndrome's symptoms. SCP-1232 does not denature easily by heat treatment alone, and can withstand temperatures of up to 230 degrees Celsius for roughly fifteen seconds - heating with basic agents, preferably NaOH, KOH or Ca(OH)2 of normality at least 1 has been shown effective. Novosadov syndrome is a progressively developing condition caused by the introduction of a sufficient quantity of SCP-1232 into human body - a dose of approximately 50 micrograms administered intravenously appears sufficient to cause the condition in 50% of tested D-class subjects. The onset of the condition can be split into two phases. During the first phase, which sets on approximately 1-3 weeks after the introduction of SCP-1232 into the subject's body, the subject (designated SCP-1232-1) will become increasingly perfunctory and depressed. Subjective assessment along with supporting evidence (e.g., penile plethysmography data) show a significant decrease in ability to feel sexual arousal. Of interest is that the appetite tends to stay unchanged in a disproportionate amount of cases compared to a control group where depression was induced chemically, and SCP-1232-1 during this phase have a tendency to gain weight, usually 10-15 kg over the duration. At this stage, no obvious physiologic changes are present1 in males. In females, [REDACTED] instead of fluid. This phase tends to last between 6-8 months. The second phase onset is marked by a sudden loss of appetite, elevated body temperature, insomnia, and increased secretion of androgens. During the onset, SCP-1232-1 report a subjective improvement to their demeanor. Significant quantities of SCP-1232 are present in urine, and possibly other body fluids of SCP-1232-1 at this point. In addition, the menstrual cycle of female subjects is disrupted, with a large number of eggs beginning to mature, and the uterine lining thickening. In approximately 3% of the subjects, this results in acute endometriosis. Usually within the next five days, the libido of SCP-1232-1 will return and proceed to increase, becoming the defining trait of their behaviour, in the case of male instances of SCP-1232-1, overwhelming even their survival instinct towards the end of the period.2 Instances of both genders will aggressively attempt to mate with any suitable human, often settling for animals or inanimate objects if none are available. Male subjects tend to expire after a further 2-4 days due to a combination of exhaustion from lack of sleep and nutrition, and the collapse of the immune system caused by excessive testosterone levels. Female SCP-1232-1 can be separated into three groups. Those in which fertilization occurs late or not at all tend to expire due to the same reasons as male subjects. If fertilization occurs early, the androgen levels tend to drop, and SCP-1232-1's behavior will slowly normalize over the following days. The subsequent progress depends on the number of fertilized ovocytes surviving. The ovocytes nest and appear to undergo development accelerated roughly three times compared to regular embryos. In ~95% subjects, the amount of surviving ovocytes exceeds 20, and the subject likely expires during the first month of such pregnancy due to resulting complications. In the remaining 5% of subjects, the pregnancy progresses at the accelerated rate until the end of second month where the placentae [DATA EXPUNGED] sacs. Continuing to raise such feti in vitro is possible and once outside the mother's body, their growth rate will slowly decrease to match that of feti in the same development stage. Infants raised this way show no significant difference to control group. Recovery Log: SCP-1232 was first isolated from the bodily fluids of private V.I. Novosadov on ██/██/1954, several months after he, along with a group of Soviet soldiers participated in the decommissioning of a then-discovered underground facility located in the territory German Democratic Republic3. Private Novosadov was executed following his desertion, capture, and subsequent admission to 37 cases of rape and sodomy, perpetrated in the village of ███████, Polish People's Republic, in the vicinity of a Soviet military base, over the course of two weeks. Agent Golovanov4, by the time infiltrated within the Soviet army as a telegraphist, has managed to capture a coded depeche ordering the prompt incineration of Private Novosadov's remains, and was able to obtain tissue samples and a copy of the autopsy report. The events following this are unclear due to Agent Golovanov's death (See Personnel File 1934-135-13-IPG), however, it is known that all of Novosadov's surviving victims disappeared approximately two months after his execution. Addendum 1232-1: COPY OF MESSAGE INTERCEPTED BY SOVIET AGENTS ON ██/██/1944 DATE:██/██/1944 TO: Dr. ter Meer FROM: Dr. Meiziger Fritz, I need you to talk about our project to ████████ at the ministry again. I got shouted at by Berger again yesterday - apparently they are expecting them to leap out of their mother's twat and grab a shovel or a rifle, while we haven't even fixed the slowdown, the rest of the troubles be damned. Hell, even if we get it to work, a fourfold increase is the most I can get - I said it's a long-term solution, not miracle work we're doing here. Besides, despite the [REDACTED], yesterday's bombing raid means half our supplies are in the devil's arse, and what's worse, Klaus was overseeing [REDACTED], and you know a good half of the synthesis process was his work alone. Anyways, write how will it go and send my greetings to Ilsa, she still works at [REDACTED] , not so?. As soon as we push the red swine out back again, and I'll be able to take a few days off, I'll jump on a train and come. Gott mit uns. Martin Footnotes 1. Towards the end of this stage, approximately 22% of SCP-1232-1 will release SCP-1232 through sweating. 2. SCP-1232-1 can transmit SCP-1232 via sexual intercourse - this tends to occur successfully in approximately 25% cases under laboratory conditions 3. At the time, Foundation agents were unable to determine the precise location or contents of the facility. Data obtained since indicates it was emptied and demolished by agents of GRU Division "P" on ██/██/1955, and that the facility has formerly belonged to the Bayer pharmaceutic concern, at the time a part of IG Farben conglomerate. (See Addendum 1232-1) 4. Posthumously awarded Foundation Gold Star for his services « SCP-1231 \| SCP-1232 \| SCP-1233 » _ccbiohazardbiologicalcontagiongru-division-pmind-affectingreproductivesafescp page revision: 12, last edited: 14 Sep 2022 19:41 Edit Rate (+80) Tags Discuss (32) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1233 rating: +820+–x close Info X SCP-1233: The Lunatic Author: CadaverCommander Image Credit: https://pxhere.com/en/photo/1366166 More by this author rating: +820+–x Item#: 1233 Level3 Containment Class: keter Secondary Class: none Disruption Class: ekhi Risk Class: danger link to memo SCP-1233, circa 1986. Special Containment Procedures: SCP-1233's anomalous physical properties all but preclude the possibility of primary containment, and as such secondary containment measures are considered adequate until a feasible method of physical containment is devised. Foundation satellite observation network ARGOS1 is to enter priority 2 high alert status 3 years and 6 months following the last observed SCP-1233 departure event. When ARGOS detects SCP-1233 in the upper thermosphere, a contingent from any nearby covert amnesticization and disinformation Mobile Task Force will be dispatched to the population center closest to the terminus of SCP-1233's descent trajectory. • After the entity's departure from Earth orbit, all appearances of and damages caused by SCP-1233 are to be accounted for with a suitable cover story in conjunction with media blackout, and any civilians having witnessed an overt display of SCP-1233's anomalous effects are to be amnesticized at MTF discretion. Mass amnesticization of the affected city may be authorized in the event of unusually prolonged SCP-1233 appearances. Update October 5th, 2017: Under no circumstances are Foundation personnel permitted to interact with or engage SCP-1233 in any capacity. Description: SCP-1233 is a humanoid entity of unknown composition, which visually resembles an individual wearing an EMU2-type spacesuit with opaque visor and attached extravehicular propulsion jetpack. The equipment worn by SCP-1233 exhibits a number of anomalous properties. The suit itself has shown durability far exceeding that of a standard spacesuit; SCP-1233 has to date withstood small-arms fire, anti-tank munitions, landmines, white phosphorus munitions, and in one instance total submersion in magma without sustaining any observable damage or decrease in functionality. The suit material is also opaque to all attempted forms of penetrative scanning, up to and including ultrasonic, radio, microwave, and x-ray emitters. The entity's jetpack, while ostensibly designed to be practical only in low-gravity orbital conditions and powered by compressed nitrogen, instead appears to utilize some form of anomalously high-powered rocket propulsion system. This device can sustainably generate thrust capable of rapidly accelerating the entity to a maximum observed velocity of approximately 40,500 kilometers per hour3, and can alter SCP-1233's trajectory in any direction at speeds and rates of acceleration/deceleration that would be instantly fatal to any human. SCP-1233's physical strength is correspondingly anomalous. It has demonstrated the ability to lift and throw objects weighing up to 65,000 kilograms and can do so repeatedly without showing any external signs of fatigue, in defiance of multiple physical laws. SCP-1233 is capable of communicating through a loudspeaker installed in its suit, and does so in a loud, somewhat grandiloquent and declamatory male voice, demonstrating fluency in a number of languages and adjusting its speech to conform with whatever language is most commonly spoken by the surrounding populace. Its statements are generally coherent in structure, but are frequently rambling, oblique, irrelevant to the present situation or lacking discernible context. SCP-1233's behavior is erratic, unpredictable, gregarious, cordial, and somewhat destructive, though its appearances are typically brief and infrequent, with sightings occurring only once per 4-5 years. An SCP-1233 arrival event will begin with the entity falling from an unknown height above the earth's surface, generally at a terminal velocity comparable to that of a small meteorite or atmospheric re-entry vehicle. SCP-1233 will exhibit the red-orange thermal radiance typical of these objects as a result of atmospheric friction, and as such SCP-1233 is commonly mistaken for a meteorite or “shooting star” during its descent. It will then crash-land, causing a minor localized seismic event and a sizable impact crater. In almost all cases, SCP-1233 has landed a moderate distance4 away from the outer limits of a population center, usually a small to mid-size town with a population not exceeding 30,000. It will then climb out of the crater, and travel toward the nearby town either via flight or on-foot. Its route to the population center is usually not direct; SCP-1233 will frequently stop to engage in various activities, seemingly at random. Examples of observed detour behaviors include: Inspecting various objects, such as farm equipment, buildings, and plants Standing still for variable amounts of time Chasing small insects, such as grasshoppers and butterflies Attempting to greet, converse with, or interrogate animals such as livestock and birds Pulling up root vegetables or picking fruit from bushes/trees and pressing them forcefully into its closed visor in an apparent attempt to “eat” them Marching directly into bodies of water such as ponds and lakes, among others, normally not resulting in significant property damage. Upon reaching the town limits, SCP-1233 will engage in further activities which, due to its curiosity, appearance, extreme physical strength, and lack of understanding of human societal conventions will generally result in civil unrest and destruction of public and private property. The following video transcript provides a typical example of SCP-1233 interaction with the local populace. Date: August 9th, 2009 Media Origin: Security camera footage confiscated from Sam's Sweets, a bakery and cafe located in downtown Saratoga Springs, NY, USA. (SCP-1233 opens front door and enters cafe. Behind the counter is an overweight, bearded man identified as Bob Parsons, 32, co-owner of the establishment. Parsons raises his eyebrows upon SCP-1233's entry.) Parsons: Holy crap dude, it's like… 90 degrees out there. I get being dedicated to your cosplay and all that, but goddamn. (SCP-1233 approaches the register and salutes briefly.) SCP-1233: Greetings, little girl. I am Moon Champion, champion of the Moon, defender of space justice and destroyer of evil. I have come once again to your charming world to learn more of your strange culture, and to seek aid for my people in their ongoing war against the Moon Monsters. You appear to possess a vast wealth of the fabled nutrients and moisture for which this world is known throughout the galaxy. Are you the President of this planet? (Pause. Parsons laughs uproariously for approximately a minute, then reaches into a display case below the counter while wiping tears from his eyes.) Parsons: Holy fuck, man. That's the funniest shit I've heard in like, at least a year. What's up Moon Champion, I'm Bob, and you get a free cookie for making me bust a gut so hard I thought I was gonna puke up my own spine. Here. (Parsons offers the cookie to SCP-1233. The entity takes it from the shopkeeper.) • • • • • • SCP-1233: Ah. One of your human “parakeets”, I see. Yes. I, Moon Champion, accept this small bird on behalf of the Moon, and solemnly pledge to use the energy it provides to advance the cause of righteousness. (SCP-1233 rams the cookie into its unopened visor. The impact instantly destroys the confection and forcefully scatters crumbs in all directions.) SCP-1233: Delicious! I thank you, Lord President of Earth, for this generous gift, and may the light of Justice forever shine upon your royal visage. (The baker laughs again and begins eating a cookie of his own.) Parsons: … Nah it's cool Moon Bro, I'll just clean that up later, don't worry about it or anything. So there's monsters, huh? On the Moon? And you fight 'em? SCP-1233: Your understanding of the situation is flawless, my Lord. Yes, the dreaded Moon Monsters have plagued and besieged my people for countless millennia. They are very terrible; merely attempting to describe them to you would cause your human organs to shrivel in horror. And it is my sacred duty as Moon Champion to meet these nightmarish beasts in combat, and lead the Moon People in the defense of their imperiled homeland: the majestic and magnificent Moon Kingdom. (Parsons continues eating his cookie, and nods.) Parsons: Oh, so you're like, one of these alien dudes. Their king or something. SCP-1233: No. I am not one of the Moon People. I am Moon Champion. I will continue to serve the Moon People, and wage glorious war against their enemies until my debt to the Moon King is repaid. But the Moon Kingdom is a land of peace and enlightenment, the Moon People having abandoned the pettiness of violence and bloodshed eons ago. They are ill-prepared for the sudden advent of such a formidable foe, and the conflict goes poorly despite the valiant efforts of me, Moon Champion. And so I have come once more to Earth, our closest neighbor, to seek whatever assistance lies within your damp, meaty hearts. (Throughout this monologue, SCP-1233's right arm has risen into the air gradually until its hand is outstretched above its head. Parsons points at it.) Parsons: Do you uh… have a question? SCP-1233: Yes. Several. To start, are these “puppies” you have capable of withstanding the vacuum of space without additional shielding? I would like to befriend one, and name her Moon Pup, and take her with me on space adventures. Parsons: Your arm, dude. (SCP-1233 pauses, then turns its head to look at its arm.) SCP-1233: Ah. Yes. It has become buoyant, an aspect of your mighty balloons. Another common side-effect of your Earth atmosphere, similar to electricity and swarms of locusts. Either that or there are Laser Beasts within this quadrant. I have studied the Earth quite extensively. Its phenomena are disgusting and incredible. Parsons: … Huh. SCP-1233: Now, Lord President Mayor of Earth, will you answer the Moon King's call, and assist us in our desperate battle against the Moon Monsters? Time is of the essence. Time waits for no Moon Champion. I have asked it nicely. It did not listen. Parsons: Oh. Uh… So like, as you can see, Moon Dude, as President I have uh… responsibilities. This uh… supply depot here is the only source of food for my people, and I've gotta like, stay here. Otherwise there'll be a famine, you know how it is. But I've ordered the citizens to lend a helping hand to anyone who asks, and uh, look! Right outside, there's some. (SCP-1233 turns to look out the glass door, where there are passersby visible.) SCP-1233: Yes. Of course. You have been most voluptuous, my liege. Farewell, glorious and corpulent President. May you and your people remain moist and rubbery. Moon Champion blasts off, on wings of justice! (SCP-1233 salutes once more, turns about, and marches forward, crashing directly through a section of concrete wall less than 10 feet from the establishment entrance.) Other observed behaviors have included: Wandering into traffic, which due to its anomalous properties has resulted in lethal collisions Breaking through glass storefronts to handle or inspect wares on display Challenging a fire hydrant to single combat, which it then destroyed via punching Stealing and gathering unattended bicycles, forming a pile of hundreds in the center of a public park Stacking parked cars on top of one another Collecting as many dogs as possible and attempting to use them as currency to purchase more dogs, and more. SCP-1233's exploits invariably result in the local authorities being summoned by the citizenry, however attempts by police to impede, detain, or arrest SCP-1233 are entirely ineffective and are ignored by the entity in the majority of cases. To date, SCP-1233 has not caused overt and deliberate harm to any civilian, though casualties and fatalities have occurred as a result of its unpredictable behavior and physical properties. After spending a variable amount of time5 within a given municipality, SCP-1233 will abruptly activate its jetpack and ascend directly upward, reaching escape velocity and exiting Earth's atmosphere with greater speed than any non-anomalous vehicle on record. Ground-based and orbital telescope observation of recent SCP-1233 departures have shown that its general outbound trajectory is consistent during each event: SCP-1233 exits Earth orbit and maintains velocity while adjusting course directly toward the Moon. At its average speed of roughly 40,500 kilometers per hour, the entity enters lunar orbit within approximately 9 hours. It will overshoot slightly and adjust course, passing out of view and presumably either demanifesting somehow or landing on the far side of the Moon. None of SCP-1233's claims regarding the Moon have been successfully verified. Since SCP-1233's initial appearance on February 6th, 1986, Foundation research divisions have maintained constant surveillance of the Moon in an attempt to acquire concrete proof of its statements. No evidence indicating the existence of a Moon Kingdom, Moon People, Moon Monsters, or any other Moon-based extranormal objects or entities mentioned by SCP-1233 has ever been found. • • • • • • Terrestrial research personnel have maintained continual contact with Lunar Area-32 provisional research station supervisors concerning all aspects of SCP-1233 since its initial registry, hypothesizing that Area-32's powerful and comprehensive SENTINEL array would be capable of confirming or refuting SCP-1233's allegations with ease. Not only have Lunar Base personnel consistently failed to uncover any indication that SCP-1233's assertions are authentic in any way, but no anomaly or object matching SCP-1233's description has ever been recorded by SENTINEL's hundreds of detectors, despite the existence of a multitude of Earth-based telescopic video recordings which clearly show SCP-1233 entering the inner bound of SENTINEL's optimal sensor range and flying directly over Lunar Area-32. Lunar personnel were only made aware of the entity's existence in the SCP registry upon terrestrial command's request that they transmit all data concerning SCP-1233's first appearance to Earth for storage and analysis, three hours following the entity's disappearance. No such data existed. No definitive explanation for this observational discrepancy has been found. Addendum 1233-01: During SCP-1233's most recent arrival event on October 5th, 2017, SCP-1233 addressed a male civilian6 in downtown Hereford, England. SCP-1233 approached Godsall and asked him if he would be willing to join the fight against the “Moon Monsters”. As opposed to each observed iteration of this interaction thus far, in which the civilian petitioned by SCP-1233 either disregards the question or answers in the negative, Godsall sardonically replied, “Oh absolutely, you fucking nutter. I'm ready to go right now, got my toothbrush and everything. Let's fly, spaceman.” SCP-1233 responded, “At last! A brave warrior, hiding in plain sight amidst these pastoral and bucolic humans! Let us away, fair meatfellow, and earn the glory of heroes! This day, you brush your tooths amongst the stars! We fly!” The entity lurched forward and embraced Godsall, then activated its jetpack. The resultant sonic boom shattered every item of glassware within a 300-meter radius as SCP-1233 accelerated to a projected velocity of 25,000 kilometers per hour within approximately four seconds, ascending into low orbit with Godsall in tow. Due to the unexpected timing of this event, observational satellites were unable to properly focus upon SCP-1233 during the early stages of its exit trajectory. As such, Godsall's presence and status were unable to be visually confirmed. After the amnesticization of all Hereford citizens witnessing this event, Godsall was officially declared missing, then pronounced dead three months later. The condition and whereabouts of his remains are currently unknown. Footnotes 1. Atmospheric Reconnaissance Global Observation System 2. Extravehicular Mobility Unit, a model of spacesuit worn by NASA and International Space Station crewmembers. 3. Slightly greater than Earth's surface-level escape velocity. 4. Between 7 and 30 kilometers 5. Shortest observed thus far approximately 30 minutes, longest 7 hours 6. Later identified by recovered security camera footage as Harry Godsall, 27 More From This Author CadaverCommander's Works SCPs SCP-4333 • SCP-5902 • SCP-3983 • SCP-4449 • SCP-3894 • SCP-4999 • SCP-3988 • SCP-3396 • SCP-4233 • SCP-3885 • SCP-3897 • SCP-3895 • SCP-3884 • SCP-3898 • SCP-4933 • Tales/GoI Formats The Shape of a Gun • Joey Makes a New Friend • Joey Fucknuts Believes In Himself • Joey Fucknuts Takes to the Skies • Joey Fucknuts Builds a Flying Machine • Other CadaverCommander's Mobile Assault Necropolis • « SCP-1232 \| SCP-1233 \| SCP-1234 » ‡ Licensing / Citation Cite this page as: "SCP-1233" by CadaverCommander, from the SCP Wiki. Source: https:// scpwiki.com/scp-1233. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. Filename: moonchampion.jpg Name: Free Images: person, black and white, astronaut, soldie,r monochrome, monochrome photography, profession, Free Images Author: N/A License: Public Domain Source Link: Pxhere _cc_licenseboxairborneectoentropicextraterrestrialhumanoidindestructibleketermoonmoon- championsapientscpsuperherouncontained page revision: 47, last edited: 14 May 2024 14:43 Edit Rate (+820) Tags Discuss (77) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1234 rating: +208+–x Item #: SCP-1234 Object Class: Keter Special Containment Procedures: Ownership of the building housing SCP-1234, designated Site 602, is currently held by a Foundation front company. All other former tenants of Site 602 have been evicted. The Foundation is to liaise with local government and business interests to prevent any attempts to purchase, redevelop, or condemn Site 602. Plainclothes security personnel are to monitor SCP-1234 when inactive to prevent unauthorized access. Electronic monitoring equipment is to be installed in SCP-1234 and throughout Site 602. Whenever monitoring indicates that an SCP-1234 event is imminent, all Foundation personnel are to evacuate Site 602. A Foundation front company, Southside Commissary Products, is to make a delivery to SCP-1234 within 6 hours containing at least 50 kg each of all-purpose white flour and vegetable shortening, as well as 200-400 kg of any other available products approved as per Document 1234-746-C. Following conclusion of an SCP-1234 event, Foundation personnel may reenter Site 602. All instances of SCP-1234-1 are to be identified and removed for study and disposal. All monitoring equipment is to be examined and replaced as necessary following confirmation that SCP-1234 has been fully secured. Concurrent to reentry, Southside Commissary Products shall canvas all purveyors of baked goods within a 5 km radius of SCP-1234 and confiscate any uncontained instances of SCP-1234-1. In the event that a delivery is not made by the time SCP-1234 enters active phase, mass distribution of amnestics to the civilian population is authorized, and Procedure Queen- of-Hearts may be enacted, as necessary, at O5 discretion. Description: SCP-1234 is the former premises of "Schmidt's Swiss Pastries", a bakery and tea room that operated in Chicago, IL from 1947 to 2003. The interior of SCP-1234 remains fully furnished and possesses working electricity, hot and cold running water, and natural gas. SCP-1234's ovens and kitchen equipment remain fully functional, though appearing to be in a severe state of disrepair due to age and neglect. All attempts to remove or disconnect SCP-1234's kitchen equipment or utilities have been unsuccessful. Under normal circumstances, SCP-1234 is inert. On an irregular basis, ranging from an observed minimum of 2 days to an observed maximum of 17 months, 12 days, SCP-1234 becomes active. Prior to becoming fully active, SCP-1234 exhibits a "warmup" period lasting from 12 to 36 hours. Phenomena indicating the onset of an SCP-1234 event include: Heavy electromagnetic fluctuations within a 100m radius of Site 602 Interference and malfunctioning of monitoring equipment Electrical blackouts/brownouts on the city block Site 602 is located on • • • Lights and electrical devices within SCP-1234 activating and deactivating spontaneously Unexplained disappearances of humans and animals within a 300m radius of Site 602 [REDACTED] SCP-1234 will become fully active within no more than 36 hours of the commencement of the warmup phase. To date, active phase has always initiated between the hours of 23:00 and 03:30 local time. Once fully active, SCP-1234's windows become fully opaque, all doors and windows become completely impenetrable, and all monitoring equipment located within SCP-1234 ceases to function. All attempts to enter SCP-1234 during an active phase have failed and no persons inside SCP-1234 when an active phase commences have been found alive at its conclusion. Active phase has been documented to last from 4-10 hours, but will always conclude by 09:00 local time. Upon conclusion of active phase, the shelves, counters, tables, and display cases of SCP-1234 will have been stocked with approximately 200-500 freshly baked, shortbread-crust pies designated SCP-1234-1. All instances of SCP-1234-1 measure 22.8 cm in diameter and weigh approximately 0.75 kg each. Pies produced by SCP-1234 will make use of any biological ingredients provided to it, whether living or not at time of event, including fruits and vegetables, non-edible plants, insects, fish, poultry, red meat, and human beings. SCP-1234 will not, however, make use of any ingredients that are spoiled, stale, or are of unsatisfactory condition for use in baking. Instances of SCP-1234-1 will not be recycled into new instances when a new event begins. All instances of SCP-1234-1 are, at time of discovery, cooled to room temperature, contained in a disposable aluminum pie plate, and covered with a transparent plastic lid. Aside from the means by which they are produced, SCP-1234-1 bear no anomalous properties and may be eaten safely providing that the ingredients used in its manufacture are safe to eat. On 17 occasions since observation began, instances of SCP-1234-1 have been found outside SCP-1234 following conclusion of active phase. On all such occasions, the pies were found on the shelves of supermarkets, convenience stores, and other food vendors within a 5km radius of SCP-1234, and had been labeled with a UPC readable by the vendor's point-of-sale system. No determination has been made as to how the pies were transported from SCP-1234 to the locations where they were found. If there is not a sufficient supply of ingredients available within SCP-1234 when active phase commences, SCP-1234 will consume ingredients stored outside itself. Flour, shortening, and other biological matter is relocated into SCP-1234, beginning with the closest matter available and being attracted from an increasingly greater distance until the necessary amount of ingredients has been acquired. The means by which material is acquired or transported into SCP-1234 is unknown; due to the population density of the area in which SCP-1234 is located, no uncontained events have been allowed to occur since containment began. Foundation containment of SCP-1234 began in 2006, following several reports of dozens of persons and animals disappearing within the downtown Chicago area. Local police traced the disappearances to the neighborhood in which SCP-1234 is located. Upon noticing an unusual scent emanating from the abandoned storefront now identified as SCP-1234, police breached the front door and discovered approximately 7,300 instances of SCP-1234-1 within, many of which were several months old and had spoiled. When police attempts to determine the identity of the persons responsible reached a dead end, a police liaison contacted the Foundation, which assumed • • • jurisdiction and, following an additional event which resulted in several more disappearances, placed SCP-1234 under containment. Interviews with persons who worked at SCP-1234 prior to 2003, and with the previous owners of Site 602, stated that the cause of its closing abruptly in April of that year was not known to them and that they had never observed any unusual or anomalous events occurring within the property prior to 2006. « SCP-1233 \| SCP-1234 \| SCP-1235 » _licenseboxautonomousbuildingevent-featuredfoodketerscp page revision: 39, last edited: 21 Oct 2022 08:09 Edit Rate (+208) Tags Discuss (67) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1235 rating: +309+–x Item #: SCP-1235 Object Class: Euclid Special Containment Procedures: SCP-1235 currently occupies a laboratory desk in Examination Room 3, which has been converted into a containment cell. SCP-1235 should be kept under high-resolution video surveillance and any developments catalogued. Any expansion of the Austrian installations around SCP-1235 or other macroscopic activity should be considered a breach attempt in progress and the area locked down immediately. In the event of a breach attempt by one or more international actors within SCP-1235, all ventilation systems throughout Site-25 are to be shut down. During a breach event SCP-1235 should be considered a chemical, biological and as of Containment Breach 1235-3 radiological hazard. SCP-1235-1 is to be kept in secure storage when not in use. Description: SCP-1235 is a large illustrated German-language atlas of the world (Andrees Allgemeiner Handatlas). The title page claims the atlas to have been printed by Velhagen & Klasing in 1903 as the 3rd revision of the 1899 4th edition; the publisher has no record of this printing. Initial recovery indicated that pages handle normally and otherwise appear non- anomalous. Under microscopic analysis, however, details such as state names, city locations, and shading for discrete political entities fail to appear. Instead, at higher magnifications the atlas depicts a photorealistic satellite view of the magnified area. SCP-1235-1 is a brass achromatic microscope outwardly consistent with equipment contemporary to SCP-1235's stated date of publication and stamped with the legend 'ADLERAUGE MCMVII'. Its internal workings, however, are highly complex and constitute an innovative method of magnification that relies on superposition of light via a microscopically perforated baffle. The construction of this baffle is beyond known manufacturing methods at the time of SCP-1235-1's ostensible construction. In normal operation SCP-1235-1's maximum magnification is approximately 1,000X - when viewing SCP-1235, however, its instrumentation permits far greater increases in magnification. No upper limit has been established on SCP-1235-1's magnification while viewing SCP-1235 - under experimental conditions it has proven capable of excellent clarity at over 300,000,000X magnification. Analysis of SCP-1235 using SCP-1235-1 indicates that SCP-1235 represents a microcosm: nations within SCP-1235 are composed of apparently sentient beings at a scale of approximately 1:25,512,400. A typical microcosmic individual is approximately 700 angstroms tall and as far as can be ascertained is composed of microcosmic particles on a similar scale to their non-anomalous counterparts. When SCP-1235 is opened to any given page, time begins to pass at a highly accelerated rate (approximately 1:300) in the world it portrays, beginning from the atlas' supposed date of publication (1903). Closing and re-opening the page resets the world within SCP-1235 to 01/03/1903; the inhabitants of SCP-1235 seem to retain awareness through this reset, and have made several attempts to prevent further interference, culminating in Incident 1235-01. Although microcosmic events chronologically prior to 01/03/1903 apparently proceeded historically, significant diversions from historicity have been noted following extended observation. Shortly after recovery, SCP-1235 was left open to pages 7-8 - a full-page spread of Atlantic Ocean trading routes - for 7 days. During this time, geopolitical/ geosocial disturbances were observed throughout the area covered by the map. It appears that, as soon as time begins to pass within SCP-1235, its inhabitants become aware of macrocosmic reality — though it is uncertain to what extent they are able to resolve images from macrocosmic light and thus accurately perceive the nature of the wider world. The rapid rise to hegemony in Europe and Africa of a federated Austro-Hungarian state - possibly predicated on the proposal for a 'United States of Austria' floated in macrocosmic history by Aurel Popovici - seems to be a common and inevitable outcome of iterations of the microcosmos viewed via Pages 7-8. Experimentation on other pages has been suspended following Incident 1235-01 and subsequent breach attempts. Several attempts have been made to contact contemporaneous Foundation assets in Britain and the United States through microstenography - microdots measuring under 1nm were dropped onto unpopulated areas of Canada and African wilderness under British control. Thus far it is unclear whether these objects have been correctly interpreted - the hostile nature of the Central European powers makes close observation increasingly difficult. If communication with a microcosmic Foundation is established, the fate of Site-██ in the western United States (not depicted on the map) is to be determined as a priority; containment breach of a microcosmic version of SCP-███ constitutes a possible XK-class event and it is not at all clear that this would be confined to the microcosmos. Until its status can be ascertained, attempts to neutralise SCP-1235 via removal of light sources or destruction of part or all of the atlas cannot be countenanced. Recovery Log 1235 SCP-1235 and SCP-1235-1 were recovered from the Cambridge offices of Dr Arnold ████████, a Bavarian-born historian and known cartographic enthusiast who had been previously used as a consultant by Sector-30 in matters relating to SCP-████. The whereabouts of Dr ████████ are currently unknown and he has since been reported missing. A hastily written note was found near the objects; handwriting analysis indicates this to have been penned by Dr ████████. The note, translated from German, reads 'both quality and detail are incredible'. It is uncertain whether this missive refers to SCP-1235, SCP-1235-1, or both. Incident 1235-01 On ██/██/20██ SCP-1235's object class was upgraded to Euclid following unprecedented activity by microcosmic state actors in the third week of sustained observation. The Austrian Empire, supported by German and possibly Belgian and Romanian allies, launched a significant fleet of vessels into macrocosmic space, apparently powered by glucose harvested from dust falling onto SCP-1235. Professor ██████ was attacked by a number of these objects, which used several milligrams of high explosive to destroy his eardrum - it appears their intent was to enter his brain and cause life-threatening damage; fortunately the Austrian forces appear to have underestimated the extent of this explosion in the confined space of Professor ██████'s ear, disabling the portion of the fleet assigned to the attack. The remainder of the force, however, was successful in rapidly constructing makeshift clamps from surrounding material to prevent further manipulation of the pages of SCP-1235. Examination Room 3 was designated a high-priority containment area and sealed off from the surrounding facility. The central European alliance has since reinforced their beachhead with pressurised habitat domes and artillery emplacements based around the clamps, which have been progressively strengthened. Several attempts have since been made at resetting Pages 7-8 or closing SCP-1235; in each case this has resulted in an increasingly lethal counterattack by forces from the microcosmos, usually attempting to breach containment or attack researchers assigned to SCP-1235. During Containment Breach ████-03 it became evident that at least the Austrian state has developed atomic weaponry: though these devices are generally less hazardous to personnel than previous attempts by various state actors to modify macrocosmic viruses, SCP-1235 military assets have proved highly capable of targetting these weapons towards eyes, eardrums and other sensory apparata where they are able to do damage on a macroscopic scale. En masse, they have also been successful in breaching Chemturion suits. The americium pellet in Examination Room 3's smoke alarm has also been seized, apparently in the belief that this mass will be fissionable via microcosmic explosives. The increasing sophistication and hostility of agents within SCP-1235 is a matter of extreme concern to sector management; reclassification to Keter-class is pending. « SCP-1234 \| SCP-1235 \| SCP-1236 » ‡ Licensing / Citation Cite this page as: "SCP-1235" by SRegan, from the SCP Wiki. Source: https://scpwiki.com/ scp-1235. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxdocumenteuclidhostilemicroscopicsapientscp page revision: 43, last edited: 21 Oct 2022 08:23 Edit Rate (+309) Tags Discuss (64) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1236 rating: +117+–x Digital scan of SCP-1236 1-4 Item #: SCP-1236 Object Class: Safe Special Containment Procedures: SCP-1236 1 to 4 are to be draped with black, light- blocking fabric and kept in locked cases when not being studied. These cases may be stored in the same storage area. The locks securing each case will be individually keyed. Upon removal from the case, any of SCP-1236 1 to 4 will be placed upon a floor- mounted easel, still draped in the black fabric. Only when the set-up team is safely behind the paintings, will the black fabric covers be pulled back to reveal the images painted upon the canvas. Description: SCP-1236 is a series of 4 paintings, labeled SCP-1236 1 through 4. Each is 100cm high by 75cm wide and are framed with plain, black wooden frames. They are painted in a style reminiscent of Keith Haring, though signed on the back with the name “Serl”. When viewed through a remote viewing device such as a monitor camera, by way of a mirror, through a sheet of glass, or a recorded image such as video footage or still picture, the images feature a colored background with a differently colored figure in the center of the image. The figure is humanoid in shape, with no physical features other than head, arm, leg and torso outlines, as is typical of Haring’s work. When viewed directly, however, each image takes on a specific characteristic, depending upon the viewer. The original image is not visible to the viewer, and instead an alternative image is seen. Following investigation into 4 staff suicides and multiple emotional/social problems reported to staff psychologists, non-D-class personnel are barred from directly viewing any of the SCP-1236 set of paintings. SCP-1236-1: This canvas will show a full-length portrait of a person who is the viewer’s ideal of physical perfection, based upon sexual orientation. This is not an image of any real person, but is a representation of every desire and subconscious drive brought together in a single individual. This individual represents the ultimate in physical and sexual attractiveness to the viewer. This impression works down to the mental/ personality level, with the viewer being able to describe in vivid detail aspects of the portrait’s personality and character traits that will make them even more attractive to the viewer. SCP-1236-2: This canvas will show an image of the viewer themself as a physically perfect specimen. They view themselves as the ultimate in attractiveness and desirability. Regardless of actual appearance, and how extreme the change to become “perfect”, the viewer will still recognize themself as the subject of the image. Again, this works to the personality level, any personality flaws are removed and more desirable traits included. SCP-1236-3: This canvas features a portrait of the viewer’s current or most recent significant other. This image, much like the previous two, projects an image of physical and mental perfection. The viewer sees their significant other rendered in the most physically and mentally appealing manner possible. Any actual imperfections are eliminated and the subject is seen in the “absolutely best possible light”. SCP-1236-4: This canvas reveals another portrait of the viewer, but in this case, in the “worst possible light”. Each imperfection is magnified and character flaws are obvious and horrendous. Upon seeing this image, the viewer is given the impression that they are a horribly repulsive person and that there is no way any person could ever be attracted to them. Addendum 1236-A All four of the paintings were found in August, [REDACTED] in an art gallery in New York City. When interviewed, the owner of the gallery could not recall where he had acquired them, but had 6 paintings in the series. He only displayed them for part of a day and reported that they made people "very uncomfortable". The owner, who wears glasses due to severe myopia, reported taking the paintings off display, but not before selling two of them to an unnamed buyer for several thousand dollars each. The remaining paintings were transferred to the Foundation, but no gallery records exist to show who may have purchased the other two paintings in the series. The owner of the gallery reported having taken the information of the individual who purchased the paintings, but that the information had somehow been deleted from his database, along with all other information related to the six paintings. « SCP-1235 \| SCP-1236 \| SCP-1237 » _ccartisticsafescpvisual page revision: 25, last edited: 16 Nov 2021 21:30 Edit Rate (+117) Tags Discuss (49) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1237 rating: +551+–x SCP-1237 as represented on an EEG readout. Item #: SCP-1237 Object Class: Keter Special Containment Procedures: Due to its pandemic and incorporeal nature, SCP-1237 cannot be contained in a traditional sense. Containment of SCP-1237 at this time shall be focused on information management and on identification and containment of SCP-1237-1-positive individuals. Any non-Foundation scientific research which could lead to discovery of SCP-1237 is to be suppressed by any means necessary. Conscription of researchers involved in such studies, as Foundation personnel or as D-class, is authorized. The Foundation is to sponsor efforts wherever and whenever possible to promote widespread DNA testing of civilians for the purpose of identifying SCP-1237-1-positives, including but not limited to mandatory testing of sex offenders and other convicted offenders, DNA testing as prerequisites for employment or insurance eligibility, DNA fingerprinting as a means of identification, universal prenatal screenings, and "home DNA testing kits" ostensibly for the purpose of determining a person's ancestry. All Foundation personnel, and any civilian who is allowed to know of the Foundation's existence, must be tested immediately. Information is to be disseminated in the medical community to the effect that an SCP-1237-1-positive result in a prenatal screening is evidence of a deformative condition with low viability and extreme health risk to the mother, and doctors are advised to recommend that such pregnancies be terminated. If a known SCP-1237-1- positive pregnancy is not voluntarily aborted, induction of involuntary abortion is authorized. The Foundation is to sponsor any and all organizations or charities providing prenatal screening and abortion services, whether legal or not, in developing countries where these services do not exist. If these efforts are unsuccessful, sponsorship of organizations participating in campaigns of involuntary sterilization, ethnic cleansing, or genocide is authorized against populations with statistically high rates of SCP-1237-1. Any person presenting at hospital or police, or otherwise identified as having experienced an SCP-1237 event, is to be detained for study and testing. If the individual is SCP-1237-1-negative they are to be debriefed, administered a Class-B amnestic, and released. Any person found to be SCP-1237-1-positive, or to have caused an SCP-1237 incident, is to be detained immediately for study and debriefing. After debriefing they are to be administered a Class-Ω amnestic and detained indefinitely. Positives are to be regularly dosed with Class-C amnestics to prevent any development of new memories regarding the existence of the Foundation or any staff handling them, benzodiazepines to minimize slow-wave sleep, and ██████████████ to prevent REM sleep and, during sleep, shall be monitored at all times by EEG. In the event that any positive enters an SCP-1237 state during observation they are to be terminated immediately. If any SCP-1237-1-L is identified by the Foundation, authorization is granted to employ them once and only once to attempt to neutralize a Keter-class SCP object at the discretion of O5. After said attempt, whether successful or not, subject is to be terminated immediately. If any high-profile person/s or public place/s is/are affected by an SCP-1237 event, the Foundation is authorized to take whatever steps necessary to prevent public knowledge of this change - up to and including termination or complete destruction of the person or place so affected. Description: SCP-1237 is a state of electrical activity in the human brain (a "brain wave" in common terminology) observed in certain individuals during periods of extremely deep sleep. This state, informally dubbed "level 5 sleep" or "epsilon wave sleep", is profoundly difficult to awaken the subject from - prior to adoption of current containment protocols, experiments with loud noise, bright lights, chemical injections, electrical stimulation, oxygen deprivation, physical injury and mutilation, and [REDACTED] all failed to arouse the subject. The ability to exhibit SCP-1237 is controlled by a gene designated SCP-1237-1. SCP-1237-1 is present in approximately 0.████% of the total world population; however, this number is as high as 1.████% among ███████, ███████████ ███████, and ██████ ethnic groups. ██% of SCP-1237-1- positives experience at least one SCP-1237 event in their lives; █% experience two or more. The majority of SCP-1237 events occur when the subject is in their late teens to early thirties. Whereas SCP-1237-1-negative individuals do not exhibit REM activity during the deepest stages of sleep, SCP-1237-1-positives do. Dreams experienced during an SCP-1237 event are not of a significantly different nature than dreams experienced by negatives; they may involve the dreamer participating in routine daily activities, find them in impossible or illogical situations where people they may or may not know behave uncharacteristically, or find them in scenarios most persons would find terrifying. As with ordinary dreams, the subject has no apparent control over the setting or events of the dream or their actions therein. When dreaming during an SCP-1237 state, however, the brain waves responsible for REM activity and SCP-1237 activity interact to produce a reality-altering effect. After an SCP-1237 event occurs, any physical or mental changes that occur to the subject in the dream will occur to their waking form as well. If the dream involves persons or places that the subject has personally interacted with or visited, those persons and places will be altered as well in accordance with the nature of the dream. Imaginary persons or places, or persons or places not personally known by the subject, are not affected. Transformation is instantaneous in all cases that have been observed. In general, memories of people not involved in the dream are unaffected. People encountering persons affected by an SCP-1237 event will believe that the changes are "correct" and that the person has always been that way; however, they will have memories that this is not the case. Attempts to reconcile this among witnesses to an SCP-1237 event tend to result in chronic uneasiness, paranoia, and [REDACTED]. Documented effects of SCP-1237 events have included; Loss of limbs and organs, or spontaneous regeneration of limbs and organs previously lost. • Complete and total changes in physical appearance, gender, personality, memories, age, or species. Acquisition of "superhuman" abilities including the ability to fly, lift extremely heavy objects, survive without oxygen, or see through solid objects. Significant changes in the architecture and floor plan of buildings, of the layout of city streets, or of the appearance, characteristics, or names of landmarks. Changes in the outcome of historical events the subject was involved in. Individuals returning to life several years after dying. The spontaneous transformation of national governments from one form to another - e.g., from a republic to a constitutional monarchy, or from a democratic confederation to an autocratic dictatorship [REDACTED] [REDACTED] A very small percentage of SCP-1237-1 positives (believed to be in single digits worldwide), designated SCP-1237-1-L, are capable of "lucid dreaming" - the ability to control the nature of their dreams, including those occurring in SCP-1237 events. To date, only one SCP-1237-1-L has been identified by the Foundation (see Experiment Log T-98816-OC108/682 for details pertaining to its disposition.) Addendum - Note from Sr. Researcher ███████: It is of the utmost importance that all agents assigned to SCP-1237 containment understand exactly how dangerous this phenomenon can potentially become. We have no idea how much of our world has been changed by these dreamers in the past. A single positive, having a single dream, has the potential to change the world for the worse. What if a mortician watches a scary movie, then falls asleep and dreams their town is part of a zombie apocalypse? What if a globetrotter dreams about the end of the world? What if someone aware of our existence dreams of a world where there's no such thing as the Foundation? We're talking CK, maybe even XK-level events here. As it stands right now, we don't even know how many of these people are out there that we haven't found. For this reason, I want to stress that any means necessary to implement universal DNA testing, and to remove these people from the gene pool, is authorized, and that there is absolutely no margin of error for "mercy". When you became part of this organization, you understood that we sometimes have to do horrible things in the name of the greater good, things that make it hard to sleep at night. I must ask you to do those horrible things, and to continue doing those horrible things for as long as it takes to neutralize this threat, because it only takes one positive who can sleep at night to create a world where the rest of us will never wake up again. « SCP-1236 \| SCP-1237 \| SCP-1238 » _ccectoentropicgenetick-class- scenarioketerphenomenonscpsleeptelekineticuncontained page revision: 27, last edited: 19 Apr 2024 10:41 Edit Rate (+551) Tags Discuss (67) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. • • • • • • • • Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1238 rating: +274+–x SCP-1238 specimen in the wild Item #: SCP-1238 Object Class: Keter Special Containment Procedures: Any wild colonies of SCP-1238 are to be destroyed as soon as possible until such time as SCP-1238 can be reduced to and maintained at pre-1850 population levels. The Foundation shall liaise with the National Oceanographic and Atmospheric Administration, and with other oceanographic research institutes as necessary, to track SCP-1238 movements and attempt to locate entrances to SCP-1238 tunnels. Any tunnel discovered should have its entrance sealed by any means necessary that will not result in seismic instability until such time as a means of completely filling in existing tunnels or rendering them structurally stable is developed. The Foundation is to monitor seismic activity within the Gold Zone at all times for indications of new tunnel construction or evidence that Event 638-Mu-34 is imminent. Whenever possible, persons living above known tunnels should be relocated. No other SCP objects, except those the nature of which renders them immovable, are to be contained within the Gold Zone. No mission-critical Foundation personnel are to travel, remain, or operate within the Gold Zone except as necessary to monitor SCP-1238 or other SCP objects within the area. No member of the O5 Council is to enter the Gold Zone at any time. Personnel whose "home town" is located within the Gold Zone, or who have immediate family members residing within the Gold Zone, are disqualified from participating in SCP-1238 containment. In the event that Event 638-Mu-34 is determined to be imminent, all Foundation personnel are to attempt to evacuate the Gold Zone immediately Foundation personnel within the Gold Zone are to effect immediate evacuation of high-ranking government officials, military personnel, and culturally significant individuals as per Plan Contra- IK-638, and to secure the retrieval and removal of listed artifacts of cultural or historical value, before attempting to evacuate themselves. Mobile Research Unit 638 is to remain on site within the Gold Zone and transmit observations and data to Overwatch Command until such time as environmental conditions render communication impossible. Following Event 638-Mu-34, the Foundation is to liaise with national governments and employ its resources for humanitarian purposes as necessary to prevent escalation to an IK-class collapse-of-global-civilization event. Description: SCP-1238 is a species of deep-sea fish with no current taxonomic classification, morphologically similar to the Antarctic toothfish (Dissostichus mawsoni). SCP-1238 resides principally in deep waters in the northern Pacific Ocean, along the northwestern American and western Canadian coastlines. Adult SCP-1238 specimens measure on average 1.4 meters in length and weigh 100-110 kg. SCP-1238 is not suitable for human consumption due to the large concentrations of toxic minerals consumed by the fish, and are not currently fished for in any significant quantity or exploited by human industry for any significant purpose. During most of its life cycle, SCP-1238 specimens subsist primarily on a diet of smaller fish and other small aquatic animals. During spawning season, which lasts from approximately early April to mid-July each year, the secondary digestive tract of sexually mature SCP-1238 specimens becomes active, allowing the fish to digest and metabolize inorganic minerals and metals, particularly deposits of metamorphic rock located below a region of the northwestern United States and southwestern Canada designated the Gold Zone. During spawning season, SCP-1238 will gather en masse at specific sites along the ocean floor and begin a process of tunneling under and through the continental shelf, widening and expanding the tunnel as a result of their consuming the existing rock. During spawning season, an adult SCP-1238 fish can consume and metabolize approximately 120% of its body mass in minerals within a 24-hour period. SCP-1238 produces little waste matter during this stage - volume of waste excreted is approximately 10% of that consumed. Tunnels produced by SCP-1238 in this manner become the spawning grounds in which SCP-1238 eggs are laid and fertilized. A female SCP-1238 fish is capable of laying up to 40,000 eggs within a season, of which approximately 25-35% will survive to adulthood under current conditions. SCP-1238 hatchlings reach sexual maturity after approximately 10 years and have been documented to live up to approximately 35 years in the wild. SCP-1238 specimens almost always return to the tunnel in which they were born in order to spawn, with tens of thousands of individual specimens involved in digging a single tunnel. SCP-1238 will continue to expand on a specific tunnel, occasionally forming branching tunnels, until natural phenomena cause the tunnel to collapse, population growth results in excessive competition for resources, or the food supply becomes inadequate. Individual SCP-1238 tunnels have been documented to extend as far as ████ km from their starting point and as deep as █ km below surface level. + Event 638-Mu-34 Background and Threat Analysis - LEVEL 4 CLEARANCE REQUIRED Memo to O5 Council: Map of northwestern United States and western Canada depicting approximate projected flooding as a result of Event 638-Mu-34. Global sea level adjustment as a result of flooding not represented. To: O5-1 - O5-7, O5-9 - O5-13, Central Ethics Committee From: SCP-1238 Research Committee Subject: Event 638-Mu-34 Threat Analysis Date: ██/██/19██ Prior to the late 19th century, the environmental impact of SCP-1238 was largely self-contained. The widespread commercial exploitation of the northern Pacific since then has resulted in the depopulation or extinction of several cetaceans and other species that previously preyed on SCP-1238, and as a result, SCP-1238's population has increased exponentially since 1850 and continues to do so to this day. In particular, tunnel construction has increased dramatically as the result of this overpopulation. Whereas we believe that approximately 200 km worth of tunnels existed in 1850, tunneling has now accelerated far beyond the rate at which natural geologic events cause tunnel collapse. We currently estimate that there are approximately ██████ km of tunnels in existence, extending up to ███ km inland from the Pacific coast, spread throughout a region of the northwestern US and southern Canada designated the Gold Zone. Damage to these tunnels has resulted in an increasing number of sinkholes and other anomalous phenomena on the surface, including the allegedly bottomless sinkhole referred to as "Mel's Hole". Computer modeling indicates that the collapse of one of the larger tunnels, or a major earthquake occurring along the [REDACTED] or [REDACTED] fault lines, could potentially cause a chain reaction (designated Event 638-Mu-34) ultimately resulting in the complete collapse of the tunnel network, the partial collapse of the continental shelf, and the permanent flooding of a large area of the Gold Zone by the Pacific Ocean to depths of up to ███ meters. If SCP-1238 tunneling continues to accelerate at current rates, our models predict a high probability of Event 638-Mu-34 occurring no later than 20██. Even if all SCP-1238 tunneling were to cease immediately, a high probability remains of Event 638-Mu-34 occurring within the next █00 years. With our current methods of seismic analysis, we believe the Foundation would be able to predict the onset of Event 638-Mu-34 no sooner than sixty minutes prior to the beginning of tunnel collapse, with continental shelf collapse occurring over the next twelve hours and complete flooding following over the next several weeks. Our models predict that few people residing within the Gold Zone, if any, would be able to evacuate upon the onset of Event 638-Mu-34; were the event to occur tomorrow, we would predict approximately ██ million human casualties within 24 hours and the destruction of approximately ██████ sq km of land, the complete destruction of the cities of Boise, Olympia, Portland, Sacramento, Salem, San Francisco, Seattle, Spokane, Vancouver, and Victoria among others, and an unquantifiably large amount of property damage. The immediate results of Event 638-Mu-34 are likely to cause a mass extinction of land and aquatic flora and fauna within and near the Gold Zone (including SCP-1238 itself) due to destruction of habitats, and will produce lingering effects for decades due to the introduction of pollution in the form of chemical and nuclear waste, debris from man-made artifacts, and large quantities of human and animal remains into the Pacific Ocean. As much of the Gold Zone is currently employed as farmland, a significant percentage of the United States food supply is likely to be impacted. We predict massive spikes in the price of food, oil, consumer goods, and other commodities as a result. Hinterlands neighboring the flooded regions of the Gold Zone are likely to suffer immediate economic devastation as a result of being cut off from the outside world; rapid onset of famine and communicable disease is expected as a result. We predict a global adjustment in sea level of approximately █ meters as the result of water displacement into the Gold Zone and major tsunami activity throughout the Pacific rim. This change will produce a significant impact on international maritime commerce and fishing, and may possibly contribute to a global economic or political crisis due to the sudden inaccessibility of vital resources. Global telecommunications are likely to be severely impacted due to the loss of telecommunications infrastructure within the Gold Zone and a massive spike in civilian communications via phone, email, social networking etc. during and in the immediate aftermath of Event 638-Mu-34. It is therefore our opinion at this time that if and when Event 638-Mu-34 occurs, the Foundation must devote as much of its resources as possible to continuity of operations and maintaining global and economic security. The unrest and devastation likely as a result has the potential to escalate into an IK-Class event, which will severely compromise the Foundation's ability to keep other SCP objects under containment and protect the human race from their influence. In the meantime, mass eradication of SCP-1238 populations will slow the acceleration of new tunneling, buying the Foundation time to develop a more permanent means of staving off that which is currently inevitable. We additionally suggest that our media resources foster the evolution of a "sustainable" culture within the Gold Zone in order to encourage population decentralization, the movement of vital technological/ industrial/military resources away from the Gold Zone, and allow populations of SCP-1238's natural predators to rebound. Postscript: Per our previous discussion with the Central Ethics Committee, O5-8 has been deliberately excluded from this memo and will not be made aware of Event 638-Mu-34 at this time. The circumstances of O5-8's early life and education, and the current residence of his extended family within the Gold Zone, may present a conflict of interest if O5-8 is made aware of the threat at this time. « SCP-1237 \| SCP-1238 \| SCP-1239 » _ccanimalaquaticfishgeologicalk-class-scenarioketerscpspecies page revision: 33, last edited: 08 Oct 2022 18:12 Edit Rate (+274) Tags Discuss (68) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1239 rating: +276+–x Item #: SCP-1239 Object Class: Safe Special Containment Procedures: Site-███ has been established around SCP-1239-2. When not in use for testing, SCP-1239-1 and removable instances of SCP-1239-3 are to be kept outside of SCP-1239-2 in dedicated storage lockers to prevent accidental activation. SCP-1239-2 should be soundproofed, with all windows obscured from the outside. Description: SCP-1239 consists of 3 (three) components: SCP-1239-1, a lamp with a standard low voltage power cable, containing artificial flora with 4 (four) flower-like lightbulbs. The words “Hey Kids!” are engraved on the lid. SCP-1239-2, a residence in ██████████, ███████. SCP-1239-3, a specific set of objects present within SCP-1239-2 at time of recovery. The anomalous effects of SCP-1239 manifest if SCP-1239-1 is powered and viewed by a post-pubescent human subject while both are within SCP-1239-2. Following this, the subject will experience a series of conditional hallucinations until exiting SCP-1239-2, as follows: Subjects will perceive samples of SCP-1239-3 to be different objects. This is apparently consistent between subjects, as all subjects tested have perceived respective SCP-1239 samples in the same way.1 Objects present within SCP-1239-2 other than SCP-1239-3 will be perceived normally by affected subjects. Subjects will perceive any prepubescent or pubescent individuals present within SCP-1239-2 as highly amiable, despite the subjects' prior dispositions or relationship with children, and will express a desire to engage in play activities. Subjects will perceive all expressions of discomfort, pain or displeasure produced by pre-pubescent and pubescent individuals within SCP-1239-2 as expressions of pleasure or enjoyment. Upon exiting SCP-1239, the hallucinatory symptoms caused by exposure to SCP-1239-1 will cease, and are removed retroactively (i. e., the subject will remember observing SCP-1239-3 samples as they would normally appear, and will be unable to recall experiencing the hallucinations previously caused by SCP-1239). Behaviour caused by SCP-1239, however, will be recalled with an expected degree of detail. As a result of this, subjects are able to recall actions made under the influence of SCP-1239, but are unable to recall the motivation for said actions. • • • • • • Summarised Recovery Log: SCP-1239 was first identified shortly after an incident occurring in SCP-1239-2 on ████-07-██, in which the respective parents of 10 (ten) children, who had agreed to meet as part of a social event, were exposed to SCP-1239-1. The affected individuals (of which there were 6 (six)) were interviewed and dealt with as per Recovery Protocol 8. A cover story regarding a toxic gas leak was later circulated, and the remains of the children incinerated after analysis. Note: Testing regarding SCP-1239 has determined that no direct or compulsive behavioural alterations result from exposure to SCP-1239-1. Excerpt from Document 1239-B SCP-1239-3 sample Description Hallucinated Appearance SCP-1239-12 A kettle composed of plastic and stainless steel. A polystyrene sword. SCP-1239-13 A large oven. A cardboard box, with the words “FORT” written on it in felt-tip pen, and an apparatus with the words “FUN CONTROLS” written above it which corresponds to the dials. The text representing the maximum temperature (200°C) the temperature dial can be set to has been replaced with the word “MAXIMUM FUN”, and the words “FUN BUTTON” have been printed above the button activating the device. SCP-1239-14 A Glock 19 pistol. A toy handgun, which produces a low-energy red laser upon the trigger being pulled. The object possesses a mechanism to load cartridges normally. SCP-1239-15 17 (seventeen) 14 (fourteen) batteries of multiple sizes. Multiple biscuits, sugar sweets and other confections, primarily coloured purple, blue and pink. SCP-1239-16 5 (five) pots and pans of varying sizes, chiefly composed of stainless steel. 5 (five) water balloons of varying sizes and colour, each filled with the near maximum amount of water that they can support. Footnotes 1. For an extensive list of SCP-1239 samples and their respective hallucinated appearances, please refer to Document 1239-B « SCP-1238 \| SCP-1239 \| SCP-1240 » ‡ Licensing / Citation Cite this page as: "SCP-1239" by Bunton, from the SCP Wiki. Source: https://scpwiki.com/ scp-1239. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxappliancehallucinationlightobservationalsafescpvisual page revision: 23, last edited: 21 Oct 2022 08:21 Edit Rate (+276) Tags Discuss (47) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-124 rating: +356+–x Item #: SCP-124 Object Class: Euclid Special Containment Procedures: SCP-124 is to be kept in a 4.2 m x 2.1 m stone pit in its containment cell. The pit is to be 1.5 metres deep. A plastic tarp is to be placed over SCP-124 when not in use. Absolutely no biological matter is allowed within one metre of SCP-124 when not being studied. An armed guard is to be stationed outside SCP-124's cell at all times. Description: SCP-124 is a plot of soil approximately 9 m2 in area and 14 m3 in size. It was recovered from a Detroit basement when authorities were notified of two teenagers growing large amounts of marijuana. SCP-124 has the ability to grow any biological organism to its full potential in a relatively short amount of time (the length varies according to the complexity of the organism). Nothing growing in SCP-124 requires external nutrients or other resources (for example, a tomato plant would not require water or light). Pesticides, too, aren't needed, as SCP-124 has a repellent effect on any insect or other invertebrates not growing in it. Any food grown in SCP-124 is reported to be of very high quality, taste, and nutrition, no matter what state the food was in before being planted in SCP-124. Document 124-1: List of items grown in SCP-124 The following is a selective list of objects grown in SCP-124 during experiments. Input - Product of SCP-124 Tomato Seed - Fully grown tomato plant. All tomatoes (12 on each plant) were ripe and juicy. Reported to be "very tasty". Small Watermelon (0.8 kg) - 11.1 kg (24.5 lb) watermelon. Reported to be "very sweet and tasty". Grass Seed (1) - SCP-124 quickly sprouted into a lush, green lawn within a matter of seconds. Slight dew on the grass. Small, overgrown hedge - A hedge, trimmed and shaped like a dolphin. Small, overgrown hedge - A hedge, trimmed and shaped like a skull. Small Labrador Retriever puppy (sandy brown) - A fully grown, bronze- colored Labrador Retriever in peak condition. Currently living with Dr. Church. Small Caucasian fetus (male) - [DATA EXPUNGED] After killing 6 personnel, the subject was terminated by SCP Containment Team. A piece of hard candy - A humanoid construct composed of hard candy. The significance of this is unknown. Fly larvae - [DATA EXPUNGED] Level 5 lockdown was initiated. « SCP-123 \| SCP-124 \| SCP-125 » ‡ Licensing / Citation Cite this page as: "SCP-124" by Unknown Author, from the SCP Wiki. Source: https:// scpwiki.com/scp-124. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxbiologicaleuclidscptransfiguration page revision: 41, last edited: 14 Sep 2022 19:44 Edit Rate (+356) Tags Discuss (41) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1240 rating: +156+–x Item #: SCP-1240 Object Class: Euclid Special Containment Procedures: News media is to be monitored for mentions of anomalous pets. Any such mention is to be investigated by MTF Omega-3 ("Zoo Keepers"). If an instance of SCP-1240-C is found then amnestics and cover stories are to be used as necessary, and the instance is to be sent to Site-██. The Internet is to be regularly searched for SCP-1240-A. Any instance of SCP-1240-A found is to be scrubbed by Foundation computer experts, and MTF Omega-3 is to be sent to the originators of the instance to investigate and administer amnestics. Instances of SCP-1240-C are housed in the anomalous animal containment wing at Site-██. Testing of instances of SCP-1240-C may be done with the permission of Dr. ██████. Personnel wishing for new instances may submit a written request to Dr. ██████. If she approves, she will procure the new instance herself. Description: SCP-1240-A is the mailing address [REDACTED]. The street █████ does not exist in ████████, and an extensive search of area code █████ has resulted in no leads. Any letter or package sent through the post to SCP-1240-A vanishes mid- route. Sending a letter or package to the adjacent house numbers ███ or ███ on the same street result in the letter or package being returned to sender. SCP-1240-B is a business, organization or entity associated with SCP-1240-A, which is simply known as "Mail Order Pet Shop". Sending a letter with a return address to SCP-1240-B at SCP-1240-A, with the letter mentioning a specific type of animal, will result in an instance of SCP-1240-C being delivered five (5) to seven (7) business days later to the return address. The letter does not need to actually place an order for an animal: simply mentioning an animal in any context will provoke a delivery of SCP-1240- C. Letters not mentioning a specific type of animal will produce no response; all requests for a catalogue of available animals have been ignored. Payment is not needed in order to receive the instance of SCP-1240-C. All checks which have been sent with requests for animals have gone uncashed. SCP-1240-C will appear at the front entrance to the return address sometime during daylight hours, at a moment when no one is directly observing the front entrance; no delivery person or delivery vehicle has ever been observed. If the front entrance is monitored by cameras the cameras will momentarily fail, and SCP-1240-C will appear during that moment. SCP-1240-C is an animal, which will always be delivered within a living environment or a means of transporting the animal. SCP-1240-C will never be the type of animal mentioned in the letter which provoked its delivery, but it always imitate some of the behaviors of the mentioned animal. Where the physiology of the animal would prevent the behaviour from being imitated, the imitation is achieved through anomalous means. What enables the anomalous behaviour is unknown, since all instances of SCP-1240-C have gross, fine and cellular anatomy identical to non-anomalous members of the same species, as well as identical biochemistry and DNA. Examples of instances of SCP-1240-C: SCP-1240-C-12: Animal mentioned: Guinea pig. Animal received: Humpback anglerfish (Melanocetus johnsonii). SCP-1240-C-12 was received in a wire cage stocked with cedar sawdust, pellet feed and a water bottle. SCP-1240-C-12 "swims" through the air via unknown means at the same height an adult guinea pig holds its body off the ground, and can move over any obstacle a normal adult guinea pig could. It is constantly coated in a film of salt water which never dries out. It has no difficulty eating vegetable matter, even though its teeth are completely unsuited for the task, and has survived for over a year on a diet of vegetables, even though anglerfish are obligate carnivores. SCP-1240-C-13: Animal mentioned: Deep-sea anglerfish. Animal received: Domestic rat (R. norvegicus). SCP-1240-C-13 was received in a fish tank filled with salt water. It was dead on arrival. Necropsy revealed that, although the specimen's lungs were full of salt water, the cause of death was not drowning, but decompression sickness. SCP-1240-C-21: Animal mentioned: Breeding pair of piranha. Animal received: Breeding pair of golden hamsters (Mesocricetus auratus). SCP-1240-C-21 was received in a fish tank full of fresh water. They breathe underwater, and "drown" when they attempt to breathe air. They swim by stroking their paws through the water, though the speed and agility with which they swim is much greater than should be possible by that means of locomotion. They eat flesh and predate on fish like piranha, but store food in their cheeks like normal hamsters. After several months in Foundation possession they mated in the manner of normal hamsters. The female grew gravid over time like a normal hamster, but engaged in no nesting behavior. After giving birth it paid no attention to its infants, similar to a female piranha laying eggs. The infants were curled up into tight little balls, and grew in size as time went by, without receiving any milk from the mother. When they reached the age that normal hamster weaned they uncurled and began swimming and eating like their parents. SCP-1240-C-30: Animal mentioned: Corn snake. Animal received: Worker ant (Tetramorium caespitum). SCP-1240-C-30 was received in a terrarium which was fitted out in a manner typical for one used to house a corn snake. SCP-1240-C-30 moves like a normal ant, and will climb over vertical and upside-down surfaces, unlike a corn snake. It seems to have the same senses and sensory range as a corn snake, but still waves its antenna when sensing its surroundings. It has shown no anomalous equivalent to the constricting behavior of corn snakes. When presented with a dead mouse, it will run at the mouse with a speed much greater than an ant should be able to achieve, and when it reaches the mouse its mouth (but not mandibles or the rest of its head) swells to an enormous size and partially engulfs the mouse. It then engages in a "gulping" behavior which moves the mouse further into its mouth. After the mouse is fully engulfed in the mouth it is slowly moved to SCP-1240-C-30's thorax, and then from the thorax to the metasoma (abdomen), with its body elastically stretching and shrinking to accommodate. When the mouse is fully in the metasoma SCP-1240-C-30 will attempt to move to a resting place. However, since its thorax and legs will be lifted off of the ground due to its distended metasoma, its legs fruitlessly wave around in the air. An hour later the waving of its legs will slow down and then stop, which is presumed to be SCP-1240-C-30 going into a dormant state. As time passes the bulk within the metasoma shrinks; it is unknown where the mass goes. When the mouse has been digested down to hair and claws the anus will momentarily swell and the remains will be expelled, at which point SCP-1240-C-30 will be able to move again. « SCP-1239 \| SCP-1240 \| SCP-1241 » ‡ Licensing / Citation Cite this page as: "SCP-1240" by Khym Chanur, from the SCP Wiki. Source: https:// scpwiki.com/scp-1240. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxaliveanimaleuclidscp page revision: 9, last edited: 21 Oct 2022 08:16 Edit Rate (+156) Tags Discuss (30) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1241 rating: +341+–x Item #: SCP-1241 Object Class: Neutralised (formerly Safe) Special Containment Procedures: SCP-1241 is to be overridden with a localised signal produced by Transmission Stations 1241-a and 1241-b, broadcasting a pre- recorded series of television programmes. A cover story regarding the production of SCP-1241 by a local studio has been circulated in case of containment failure. In order to continually monitor the content of SCP-1241, an apparatus is to be maintained to isolate and record it. Please refer to Document 1241-B for further information. Update: As of 2011-08-09, SCP-1241 has no active containment procedures. A story describing the bankruptcy of the responsible party referenced in a previously released cover-story has been released. The area is to be continually observed for any signs which could indicate a recommencement of SCP-1241 activity. Description (prior to 2011-10-23): SCP-1241 is a television broadcast transmitted in a roughly 8 x 8 kilometer area in [REDACTED], Texas, USA; the programme manifests every week on Tuesday at 23:30, for an average of 20 minutes. Analysis of the signal has revealed it to be inconsistent with standard television frequencies, and attempted replications of the broadcast outside of the original area have failed to transmit it coherently. It is not normally possible for standard televisions to coherently play signals of SCP-1241's frequency or strength. SCP-1241 resembles a television programme of the situational comedy genre. The broadcast consists of multiple episodes1 depicting the domestic life of a middle-aged human male2 and a group of 4-8 humanoid canids, who evidently share an apartment accommodation in Los Angeles, California, USA. Each episode possesses the same opening sequence (roughly thirty seconds of music with lyrics sung by an adult human female, describing the aforementioned premise) which gives a list of cast members and other individuals involved in productions, as well as giving the title of SCP-1241 as “Livin’ With Lupes”. None of the named people or the individual portraying the character of "Lad" have been successfully identified: the majority of names are associated with persons not working in an entertainment-related career. For a detailed transcription of the names and lyrics provided in said opening, please refer to Document 1241-C. The behaviour of the entities featured in SCP-1241 has inconsistently varied between typical canine and more humanoid behaviour with each episode. Summarised Document 1241-A: The following is a selection of notable examples of SCP-1241. Episode: 1, "Hemlock". Summary: The “Lad” character is introduced, shown shopping in a retail store. The character encounters “Martin Wilkinson”, one of the canid organisms. Dialogue between the two characters then ensues, during which • the Lad character mentions that he is looking for a residence. The Martin character states that he is renting a room in an apartment complex, but is looking for a room-mate. Upon later accepting the offer made by “Martin” after some deliberation and arriving at the complex, the Martin character reveals that the remaining canid entities are also living in the residence. The episode ends with a close shot of "Lad" displaying shock. Additional Notes: Excerpt of dialogue between “Lad” and “Martin”. Martin: “I had a cousin who was a talking hamster.” Lad: “Oh, really? Where is he now?” Martin: “Dead. He joined the IRA and someone ate him.” Episode: 3, “Dog Eat Dog World”. Summary: Follows several attempts made by the Martin character to seek employment after resigning from an office job, as a result of a younger individual being promoted to a higher-paid position "for the third time this year.” The character subsequently briefly gains jobs in several low-skill areas including reception, a janitorial position and clerical duties in a public library. During the first fifteen minutes, the character is dismissed from each for various reasons, including repeatedly arriving late, ineptitude and consuming a live chicken in front of several children. Episode: 14, “Big Wolf Blowing Down”. Summary: Follows the main characters coping with an unnamed hurricane predicted to affect their area of residence. The latter half of the episode focuses on their behaviour while made to remain inside due to the event. Notably, the video during this period is blurred and shaky, and the majority of the dialogue does not appear to relate to the given premise (see below), instead describing a device of undisclosed function which appears to be at risk of becoming damaged. Additional Notes: Excerpt of dialogue between “Lad” and an un-named canine character (referred to here as “Unnamed”): Unnamed: "Please don’t let it break." Lad: "I won’t." Unnamed: "It’s too important to break. It’s been so nice, being able to think." Lad: "I know. I won’t let it break. I’ll fix it somehow. I promise." Unnamed: "I suppose I should just enjoy the moment before I have to go back. At least it gave me these moments. I’ll always have that." Episode: 15, untitled (the opening sequence was not present). Summary: 19 minutes and 32 seconds of footage depicting two malnourished domestic dogs (one Dalmatian and one Great Dane) lying down in a cage. The episode terminated at 22:59 with little change in the animals’ activity, camera position or camera angle throughout. Incident 1241-1: On 2011-05-02, SCP-1241 failed to be detected at its regular time. SCP-1241 was not found to be active in the subsequent two weeks. On 2011-05-17, a rented space in ███████████████, Canada was investigated by its landlord following a failure of the individual renting it (one ███████ ██████) to make regular payment. Due to the items discovered within the residence, follow-up enquiry was later made by Foundation personnel after the landlord attempted to contact local authorities. The contents of the locale were found to be: Four large dog crates. The remains of six dogs of various large breeds and a human subject (later identified as Mr. ██████), all showing damage consistent with roughly two weeks of decomposition and partial consumption (varying between specimens). Electronic equipment, primarily consisting of that used in recording and broadcasting, including: a Panasonic-brand video camera (non-functioning) and tripod stand, a playback video monitor (non-functioning), a Boom operator and a VHS recorder/player labelled “OUTGOING EPISODES” (non-functioning). A surviving male Weimaraner specimen, displaying signs of severe deformity and malnutrition. The subject expired within an hour of being removed from the locale despite attempted medical intervention. An autopsy carried out shortly after revealed that part of its skeleton had been replaced with bones of a distinctly humanoid structure, primarily around its jaw, skull and legs. SCP-1241 was declared Neutralised on 2011-08-09. Footnotes 1. 15 at time of neutralisation. 2. The name of the aforementioned man is given as “Lad”. « SCP-1240 \| SCP-1241 \| SCP-1242 » ‡ Licensing / Citation Cite this page as: "SCP-1241" by Bunton, from the SCP Wiki. Source: https://scpwiki.com/ scp-1241. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxcaninehumanoidneutralizedperformancesafescptransmission page revision: 38, last edited: 21 Oct 2022 08:29 Edit Rate (+341) Tags Discuss (106) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. • • • • Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1242 rating: +71+–x Item #: SCP-1242 Object Class: Euclid Special Containment Procedures: SCP-1242 is to be contained in two adjoining rooms measuring 2m x 2m x 3m capable of sustaining quarantine for a Category A, UN 2814 biohazard. The rooms should be separated by an airlock. All access to subject is to be limited to a single entry point equipped with remote handling, clean room, decontamination, and quarantine facilities. Remote handling is to be used when interacting with SCP-1242 whenever possible. Level A biohazard suits are required for all non-test subjects physically interacting with SCP-1242. Nutritional needs are human normal, and should be met using standard quarantine protocols. Waste material should be treated as a Category A, UN 2814 biohazard. Waste may be disposed of only after heat-sterilization and storage for a period of no less than 14 days to ensure success of the sterilization procedures. Subject is on strict suicide watch, and is not allowed any object or material that would facilitate self-harm. Due to subject's proven capacity for self-harm, all requests made by subject must be submitted to the Site Director. Description: SCP-1242 is an adolescent Caucasian human male 137 cm in height, weighing 41 kg. Subject communicates primarily in English, is intelligent, and generally cooperative with Foundation personnel. Subject exudes a retro-viral agent, hereafter referred to as SCP-1242-1, from all bodily orifices and glands. SCP-1242-1 is 99.9% infectious when transmitted by direct contact through skin contact and 100% infectious when transmitted by direct contact through ingestion. SCP-1242-1 has been shown to be infectious to varying degrees through indirect contact for up to 14 days on average, with the longest recorded period between viral emission and infection being ~26 days. SCP-1242-1 contains an unusually large amount of fragmented genetic material and acts directly on the genetic and cellular level, temporarily reverting each individual cell to the stem cell stage through an unknown process before remaking it as a new cell. Individuals infected are to be classified as SCP-1242-1a and quarantined immediately. Infection is followed by an incubation period of 6 hours, after which SCP-1242-1 symptoms begin to manifest. Six hours: SCP-1242-1a experience acute pain in joints, fever ranging from 38-40 C, respiratory difficulty, cardiac arrhythmia, and cyanotic extremities. SCP-1242-1 ceases to be infectious at this time. Eight hours: Subjects in this stage indicate that pain is now global to the body, and intense. Symptoms diverge in this stage depending on the initial mass of the infected individual. There is currently no data on individuals exactly matching the mass of SCP-1242; however, it has been noted that symptoms beyond this point are significantly less severe for individuals within +/- 10kg of 40kg. SCP-1242-1a that are larger in mass than SCP-1242 begin experiencing violent emesis, diarrhea, and perspiration beyond the levels associated with fever temperatures. Waste produced in this manner is composed of tissue types from throughout the body. Subjects begin to gradually decrease in mass and physical size. Instances larger in mass than SCP-1242 have an estimated 43% survival rate of this stage. SCP-1242-1a that are smaller in mass than SCP-1242 begin bloating and swelling, and display a voracious appetite, with a preference for materials high in protein. Instances of SCP-1242-1a that are smaller in mass than SCP-1242 have an estimated 6% total survival rate of this stage without medical intervention. It is unknown whether such individuals could survive the full run of the infection without medical intervention. Nine hours: Symptoms accelerate as subject rapidly alters to more closely match the mass of SCP-1242. All identifying characteristics native to race are eliminated and subject's body begins restructuring to achieve the end stage result. Females have a significantly higher chance of dying due to complications associated with restructuring of primary reproductive systems in this stage. Larger instances experience a continuation of emesis and diarrhea, skeletal fracturing and restructuring, and sloughing off of skin and hair. Instances in this stage are prone to organ failure from compression, bursting, and dehydration. Hydration can increase survival rates, but not substantially. Smaller instances experience rapid growth, with associated internal lacerations and stress fractures from sudden growth of skeletal structure. It has been determined that continued nutritional supplementation substantially improves chances of survival at this stage for smaller instances, boosting survival chances from 4% to 32%. Ten hours: Subject's body structure now closely resembles SCP-1242. Symptoms converge and abate. SCP-1242-1 is once again infectious. Eleven hours: All symptoms abate. Subject is now visually indistinguishable from SCP-1242, and is designated SCP-1242-2. SCP-1242-2 may be distinguished from SCP-1242 only by testing. SCP-1242-2 do not produce SCP-1242-1 as a biological by-product, carrying and transmitting it instead as an infectious blood-borne pathogen. In nearly all other respects, SCP-1242-2 are identical to SCP-1242. • • ◦ ▪ ▪ ▪ • ◦ ▪ ▪ • • Instances of SCP-1242-2 possess intelligence commensurate to that of SCP-1242, and display a range of reactions and personality traits consistent with SCP-1242's non- depressive behaviors. Investigation into SCP-1242-2 neurochemistry reveals that instances' levels of serotonin and dopamine are elevated by an average of 15% above human baseline. This results in instances of SCP-1242-2 generally behaving docilely and showing a heightened preference for tactile sensation. It is hypothesized that instances do not develop depressive behaviors displayed by SCP-1242 due to an inability to experience strong negative emotion without an outside trigger. SCP-1242-2 have a drive to protect SCP-1242, and in the pursuit of that goal will seek out and infect individuals to propagate more instances of SCP-1242-2. In the event of a direct threat to SCP-1242, instances become extremely violent, lashing out at the perceived threat with any tools or weapons available, but will attack unarmed should they lack weapons. Autopsy of instances terminated while defending SCP-1242 indicates that levels of serotonin and dopamine drop below baseline in response to the perceived threat, with a concurrent and equal elevation in levels of epinephrine, nor- epinephrine, and testosterone. Psychological evaluation shows that individual instances continue to retain fragmented memories of their existence prior to infection, but do not display any personality traits inconsistent with SCP-1242's non-depressive behavior. Comparison of EEG's taken before and after conversion reveals significant restructuring of the frontal lobes which may contribute to this alteration of personality traits. SCP-1242 was discovered after the Foundation became aware of reports from the rural town ████████████, ██ describing identical male youths, corresponding with reports of individuals disappearing. Subject was located in an outlying structure 1.2 km outside of the town proper surrounded by 24 instances of SCP-1242-2. Subject immediately warned Foundation personnel away, but made no attempt to escape. Agents ████████ and ████ were both exposed to SCP-1242-1 in the course of interviewing the subject. Agent ████████ recognized a potential biohazard and was able to communicate the necessary precautions before succumbing to infection. Containment teams eradicated all present instances of SCP-1242-2 and took SCP-1242 into custody. The town was placed under quarantine until such time as a lack of infections was determined to exist. Class C amnestics were administered to the population, who were then relocated under a claim of eminent domain. The area of potential infection was then sterilized. SCP-1242 has displayed bouts of chronic depression associated with post-traumatic stress disorder and long-term isolation. Subject avoids discussion of the onset of its condition, and refuses to give its name. Its fingerprints do not match any on file. Addendum A: Reports of instances of SCP-1242-2 outside of Foundation control have been corroborated and neutralized on five (5) separate dates. Instances have been located as far as 4700 km from the point of initial containment. Attempts to question SCP-1242 about these instances have been met with escalation of depressive behavior and emotional withdrawal. Addendum B: Following Incident 1242-1, instances of SCP-1242-2 will be actively sought out and destroyed with all expediency. + Incident 1242-1: Site Director Clearance Only On ██/██/20██, fifty-six instances of SCP-1242-2 mounted an assault on Site ██, where SCP-1242 is contained. Instances were armed with weapons ranging from small arms to explosive munitions made from commercially available ingredients. Instances displayed coordination and tactics at a level associated with a dedicated civilian militia training full time for a sustained period. Initial incursion was minimal due to rapid response by perimeter teams and initiation of site lockdown. While initial casualties were low, casualties from infection of personnel by SCP-1242-1 were high. It is still unknown how instances were able to obtain weapons and locate SCP-1242. « SCP-1241 \| SCP-1242 \| SCP-1243 » ‡ Licensing / Citation Cite this page as: "SCP-1242" by Winterthorn, from the SCP Wiki. Source: https://scpwiki.com/ scp-1242. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxaliveeuclidhumanoidsapientscpself-replicatingvirus page revision: 15, last edited: 21 Oct 2022 08:31 Edit Rate (+71) Tags Discuss (40) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1243 rating: +220+–x Screenshot of SCP-1243 taken ██/██/200█. Item #: SCP-1243 Object Class: Euclid Special Containment Procedures: No methods of effectively containing SCP-1243 have been developed as of this time of writing. The prevention of public knowledge of SCP-1243 is top priority, and will be maintained through a number of web crawler programs designed to track down, delete, and record instances of the URL leading to SCP-1243-1. Foundation agents are undercover in several law enforcement agencies worldwide, especially those that handle missing persons' cases, to find possible instances of individuals using SCP-1243. Only personnel with a security clearance of 3/1243 are permitted to know SCP-1243's URL. To prevent the accidental spread of knowledge of SCP-1243, personnel being transferred out of work on SCP-1243 for any reason will be given class A amnestics. As it is unknown how SCP-1243 gathers information from its users or those being targeted by it, testing is forbidden at this time. Description: SCP-1243 consists of 2 components, designated SCP-1243-1 and SCP-1243-2. SCP-1243-1 is a web page with a URL of ██.██████.██/███████. To this date, the Foundation has been unable to trace this page to its server, due to the site having an inconsistent IPv4 address. The method used to obscure its true IPv4 address is unknown. This web page consists of a black (html color code #000000) background, a jpeg logo on the top-center of the page reading "████████ Relocation Services", a text field labeled "Name", a return field labeled "Cost", a button labeled "Place Order", and a counter labeled "Customers Served". All of these elements are encoded using very simple HTML. The page gives no instructions as to how to use these elements. Upon filling out the "Name" field with either a name, alias, or title of an individual, the "Cost" field will return a value, usually in USD, but occasionally in other forms of currency, valuable goods, or, in several recorded instances, a relative or acquaintance of the user. It is unknown how the cost of an individual targeted in this fashion is determined, though high-interest, well-protected targets such as government officials will typically have an extremely high cost, making them unattainable to most users. Orders that the customer cannot afford will simply be denied. When the "Place Order" button is clicked, three events will occur; the price specified in the "Cost" field will be removed from the user's possession, the individual named in the "Name" field will appear in the vicinity of the user within a period of 12-72 hours, and the "Customers Served" counter will increment by one. The individual delivered to the purchaser will invariably be the one the purchaser meant to place an order for, even though no information other than the name, alias, or title of the individual was entered in the "Name" field. General descriptions entered in the "Name" field will result in a random individual matching those descriptions being delivered to the purchaser. Instances of SCP-1243-2 are entities which appear in the vicinity of individuals "purchased" using SCP-1243-1 for the purpose of abducting such individuals. Subjects vary greatly in appearance, though they are usually described as humanoids whose features have been significantly altered by surgical or other invasive means. Instances of SCP-1243-2 have been observed entering buildings through doors inaccessible from the outside and, rarely, traveling through objects such as mirrors and television screens to reach their target. Physical violence has proven effective in stopping single instances of SCP-1243-2, though abduction events have never been prevented in this manner, as more instances will arrive to take their place. To this date, there has been no method of successfully preventing SCP-1243-2 from abducting those targeted by SCP-1243. Despite the Foundation's best efforts, the number displayed by the "Customers Served" counter continues to increase at an alarming rate. The possibility of knowledge of SCP-1243 being spread by outside sources is under consideration. Recovery: SCP-1243 was discovered following an FBI raid on a human trafficking ring in ██████, CA. The victims of this ring were found to be linked to missing person's cases in a number of different states, all of which were known to be outside the operating area of the criminal organization responsible for the ring. Additionally, the majority of the victims described being abducted by entities similar to those later designated SCP-1243-2. The URL leading to SCP-1243-1 was recovered from the hard drives seized by the FBI during this raid. All information regarding SCP-1243 was recovered from the FBI by MTF Iota-10 (aka "Damn Feds"). Both the victims of the ring and its perpetrators were given class B amnestics with false memories implanted. Incident 1243-A: On the date of ██-██-████, several instances of SCP-1243-2 appeared in [REDACTED], the location where maintenance of SCP-1243 was being performed. By the time site security could respond, SCP-1243-2 had abducted 4 researchers involved with SCP-1243. At this time, information on several other SCP items is considered compromised, including SCP-███, SCP-███, and SCP-████. As the "Customers Served" counter did not increment, it is currently assumed that SCP-1243 acted of its own volition in a defensive manner. Revision of SCP-1243's Special Containment Procedures is pending at this time. « SCP-1242 \| SCP-1243 \| SCP-1244 » _cccomputerectoentropiceuclidhumanoidonlinescpuncontained page revision: 28, last edited: 09 Aug 2020 09:51 Edit Rate (+220) Tags Discuss (40) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1244 rating: +183+–x Item #: SCP-1244 Object Class: Safe Special Containment Procedures: SCP-1244 is currently contained in lock box ██-█ in Site ██. SCP-1244 is currently under observation in storage room ██, which shares a wall with the D-Class cafeteria kitchen. Under no circumstances should the top button be pushed outside of supervised testing procedure. Description: SCP-1244 appears to be a ██████ ██████ brand stopwatch, specifically a model produced in 19██. X-ray scans of the device reveal a very complex interior filled with gears and levers of various materials. The interior bears little to no relation to the expected components, both in complexity and material composition. Attempts to replicate or even map the design based on scans have met with repeated failure, and all requests to disassemble the watch have been turned down due to risk of damaging the device. An engraving on the back reads, "I'll see you soon -C". When the button on the top of the watch is pressed, the hand of the watch will quickly spin clockwise reading a time between ten (10) and sixty (60) seconds, then begin counting down to the zero (0) mark at the normal rate for a standard stopwatch. When the hand reaches zero it stops with a loud click, coinciding precisely with an event of significance to a nearby person, with a range of at least 16 meters. The event is always the sort caused by a fixed amount of time passing, and were all in progress before the button was pushed. Statistically the number of such events occur with anomalous frequency during use of the watch, suggesting a sort of temporal causation by unknown method. Testing Log Setup: Digital clock with 30 seconds left till alarm Date: 01/13/██ SCP-1244 spun up to 30 seconds, and counted down along with digital clock. Setup: Digital clock with 8 minutes left till alarm Date: 01/17/██ SCP-1244 spun up to 53 seconds. When it reached zero, level 2 researcher ██████ burst into the room, and apologized for being late for scheduled testing. The researcher felt no strange compulsion but had been held up studying and lost track of time, and rushed through the facility in an attempt to arrive on time. Setup: All time pieces removed from room, all researchers present Date: 01/17/██ SCP-1244 spun up to 10 seconds. When it reached zero, no event was recorded. Note: This was later determined to have this coincided with the end of guard shift C. Two guards were stationed in the hallway outside the room at the time. - Dr. ██████ Setup: Researcher in far corner of room instructed to count down from 30 in his head Date: 1/17/██ SCP-1244 spun up to 27 seconds and reached zero at the same time as researcher. Note: I guess the guy counted a little fast. - Dr. ██████ Setup: Non-researchers evacuated from testing wing. Date: 01/19/██ SCP-1244 spun up to 57 seconds. When it reached zero, no event was recorded. Note: This event occurred at exactly 11PM local time, or Midnight in ████████ time where Dr. ██████'s wife was living at the time. She was furious that he missed their anniversary. - Dr. ██████ Setup: Testing wing emptied, button pushed using remotely operated robotic arm Date: 01/21/██ SCP-1244 spun up to 32 seconds. When it reached zero the robotic arm sparked and dropped SCP-1244. Note: We found a servo in the arm whose warranty expired exactly 2 years from time of purchase, matching its failure to the second. It seems that, with no obvious countdown to sync to, it… finds one. - Dr. ██████ Setup: Digital clock with 61 seconds left till alarm. Date: 01/22/██ SCP-1244 spun up to 60 seconds. When it reached zero, researcher █████ collapsed to the floor, dead of a ruptured brain aneurysm. Subsequently discovered medical reports from 90 days ago had given him roughly three months to live. Note: It may just be me, but it feels like this was a little vindictive. It is my recommendation that we consider testing done on this particular object, I'd rather not piss it off any more and risk it interacting with any other SCPs in the facility. - Dr. ██████ Incident 1244-A: On 03/19/██, cleaning staff noticed a faint ticking sound from SCP-1244's lock box. This was reported to research staff who determined that it had been activated by itself after being locked away for nearly two months. Research staff were unable to determine what it was synced with, but the object has since been moved to a room adjacent to a cafeteria kitchen. Monitoring equipment shows that it occasionally activates and syncs with the microwave clock on the far side of the wall. Since this move, this is the only additional anomalous behavior that has been recorded. « SCP-1243 \| SCP-1244 \| SCP-1245 » ‡ Licensing / Citation Cite this page as: "SCP-1244" by Crythis, from the SCP Wiki. Source: https://scpwiki.com/ scp-1244. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxapplianceclockworkpredictivesafescp page revision: 22, last edited: 21 Oct 2022 08:25 Edit Rate (+183) Tags Discuss (34) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1245 rating: +243+–x Item #: SCP-1245 Object Class: Euclid Special Containment Procedures: Mobile Task Force Zeta-4, "Ahab's Antagonists", are currently tracking SCP-1245's movements aboard the Foundation ship SCPS Archimedes. The Archimedes is disguised as a destroyer from the US Navy, allegedly pursuing illegal whalers. Local naval officials are to be informed of the presence of illegal whalers in the area and reroute commercial and private traffic accordingly. SCP-1245 is currently located at Site-412, an abandoned harbour located in ███████, ████████████. The harbor's entrance has been blocked by stone, preventing escape. SCP-1245 is to remain anchored to the harbor bed at all times. Chains and anchors are to be inspected every week for signs of damage and repaired accordingly. Foundation ship SCPS Archimedes is to patrol the harbor's entrance at all times and deter unauthorized craft under the pretense of naval training exercises. Description: SCP-1245 is a ███████-model factory whaling ship, approximately 120 meters in length. Nameplates and numbers are missing and are believed to have been removed prior to acquisition. SCP-1245 appears to be autonomous; it has been seen pursuing whales and incapacitating them via cannon-mounted harpoons (see Observation Log 1245-████-██ for video footage) before dragging them into SCP-1245. No crew members have been observed anywhere inside SCP-1245. SCP-1245 has been observed hunting and processing a wide variety of cetaceans, including stock not usually hunted by whalers. Unusual specimens gathered by SCP-1245 include dolphins (family Delphinidae), orca whales (Orcinus orca), beaked whales (family Ziphiidae), and narwhals and belugas (family Monodontidae). The majority of SCP-1245's internal structure is taken up by a central "slaughterhouse", where whale carcasses are dissected and their parts sorted for future use. SCP-1245 uses tissue obtained from whale carcasses to maintain its structure and build new additions to its hull. It is estimated that roughly 65% of SCP-1245's current mass is made up of whale components. Exploration teams have documented several rooms and decks constructed entirely of whale meat; several of these appear to be significantly altered from their original specifications. These include automated assembly lines built from ligaments and muscles, an on-board crane composed from vertebrae and ribs, a secondary rudder composed of baleen and bone, and a communications deck, with several intact whale brains connected to a central radio. Rotting or decaying parts are replaced with new components as new whale specimens are acquired and processed. Material is moved throughout the ship via a series of tubes composed from steel pipes and intestines. Significantly, the ship's engine has been heavily modified to burn whale oil and spermaceti, making the ship largely self-sufficient. The corpses of several infant whales in varying stages of decomposition adorn the prow of SCP-1245. These are believed to be trophies, collected during assaults on whale pods. SCP-1245 first came to the Foundation's attention on ██/██/████, after several "ghost ship" sightings occurred off the coast of southern Australia, followed by a marked decline in local cetacean populations. Mobile Task Force Zeta-4 "Ahab's Antagonists" are currently tracking SCP-1245's movements. Revised. See Incident Log 1245-043 for more information pertaining to containment revision. On ████/██/██, SCP-1245 was successfully lured into ████████ Harbour by playing a pre-recorded whale song, and restrained by Mobile Task Force Zeta-4 in "Operation Baleen" (see Incident Log 1245-044 for full details and casualty report). ████████ Harbour was subsequently secured and renovated by Foundation staff, and was re-christened Site-412. Addendum 1245: On ██/███/████, Archivist ██████████ discovered that the whaling ship Southern Star, a whaling ship of the same model as SCP-1245, disappeared and was deemed "sunk" in 1940. Addendum 1245-2: On ██/██/████, SCP-1245 transmitted a message in Morse code to staff at Site-412. Grammar, spelling, and punctuation remain identical. WHALE WHALE NOW CUT THE SOFTNESS OF HOT MEAT, HARPOON WHALE WHALE WHALE, REPAIR OF THE HULL, DEPRIVE THEIR BODIES OF THOUGHT AND LIFE, BLUE GREY CACHALOT RIGHT REPAIR OF THE HUL [sic] THE KNIVES ARE TO DO THEIR IMPORTANT JOBS HARPOON HOOK CUT WHALE WHALE WHALE GIVE NOW NOW NOW NOW NOW NOW This message was repeated twenty-seven times before SCP-1245 ceased transmission. As of ████/██/██ SCP-1245 has not released any further messages and does not respond to any messages sent by the Foundation. « SCP-1244 \| SCP-1245 \| SCP-1246 » ‡ Licensing / Citation Cite this page as: "SCP-1245" by Tom Serveaux, from the SCP Wiki. Source: https:// scpwiki.com/scp-1245. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxaquaticautonomouscetaceaneuclidsapientscpself-repairingvehicle page revision: 14, last edited: 21 Oct 2022 08:30 Edit Rate (+243) Tags Discuss (71) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1246 rating: +158+–x SCP-1246 upon recovery. Item #: SCP-1246 Object Class: Euclid-nuntii Special Containment Procedures: Site 1246 has been constructed around SCP-1246 in order to maintain secrecy, house personnel assigned to SCP-1246, and prevent accumulation of fauna. SCP-1246 is contained in a cylindrical tank of water seventeen meters in diameter and one meter in height. Several pumps are maintained to circulate water over SCP-1246 at a rate sufficient to prevent the accumulation of SCP-1246-1. Once removed from SCP-1246’s tank, SCP-1246-1 is to be filtered from the water and stored in concrete containers lined with steel. All iterations of SCP-1246-3 are to be recorded and logged. Amnestics are to be administered to all personnel at Site 1246 should SCP-1246-3 contain classified information. Description: SCP-1246 is a spiral structure approximately fifteen meters in diameter composed of a variety of stones. Individual stones may be removed from SCP-1246 and destroyed without difficulty; however, SCP-1246 will spontaneously and instantaneously reform in its entirety on an irregular basis regardless of damage done.1 Through an unknown process, a mixture consisting primarily of volcanic ash with trace amounts of iridium accumulates on SCP-1246's surface, increasing in depth at an approximate rate of 0.8mm/day. This mixture, designated SCP-1246-1, emits water vapor, carbon dioxide, thermal radiation, and ionizing radiation, all in levels not considered harmful to humans or the environment in the short term. SCP-1246-2 is a designation given to any non-human vertebrate that view all or part of SCP-1246, or any other member of SCP-1246-2.2 These vertebrates will approach SCP-1246 and, short of coming into contact with it or displacing any other SCP-1246-2, find a spot as close to the structure as possible. Should this be accomplished, SCP-1246-2 will focus on SCP-1246. If the center is not visible due to the presence of other animals or other obstructions, SCP-1246-2 will instead focus on a point above SCP-1246. SCP-1246-2 will remain in an alert state indefinitely. While viewing SCP-1246, SCP-1246-2 instances do not appear to require any form of sustenance or sleep, and do not suffer from inactivity-related injuries such as atrophy. Further, specimens do not age, nor are they affected by diseases or environmental factors, including SCP-1246-1. Removal of SCP-1246-2 from the presence of SCP-1246 will both remove them from their fixed state and cause the associated biological abnormalities to cease. SCP-1246 will demonstrate further anomalous behavior whenever a nuclear device is detonated on Earth.3 Whenever an event of this nature occurs, SCP-1246 will emit a series of noises, designated SCP-1246-3, audible up to thirty meters from its center. These noises are audible only to humans and electronic recording media; non-electronic recording devices and non-human animals do not respond to SCP-1246-3 or recordings of it. SCP-1246-3 lasts no less than 13 minutes and 30 seconds, and varies somewhat between iterations. A generalized transcript is available for personnel with Clearance 2/1246 (see below). The transcript applies to all iterations of SCP-1246-3 unless noted otherwise. Addendum: Transcript of SCP-1246-3 <Begin Log> 0:00 to 7:43: What is believed to be ambient noise from an unidentified urban area. Volume rises until 7:43, then cuts off. Screams are audible from 6:19 to 7:43. 7:43 to 11:22: The sound of a clock ticking once per second. Echoes are audible. 11:22 to 12:00: A series of animal vocalizations arranged in a manner that is reminiscent of the phrase "You know what you've done", repeated in twenty languages. Both the languages in question and their order varies with each iteration. 12:00 to 12:21: Silence. 12:21 to 12:25: A series of animal vocalizations arranged in a manner that is reminiscent of the phrase "No, and we never will be." 12:25 to 13:14: Forty-nine seconds of monologue. While variable between iterations, in each case, the speaker has been a current or former leader of a nation or organization in the possession of nuclear devices. The content of the monologue consistently centers on foreign policy. All monologues documented thus far have corresponded to speeches delivered by the leader in question. 13:14 to 13:30: A sequence of eight digits as expressed in Morse code via telegraph key, varying for each iteration. <End Log> Addendum: When interpreted as a date in the form DD/MM/YYYY, the final sequence of digits in SCP-1246-3 corresponds to a date no less than two centuries in the future. On three occasions, the date 30/07/2071 has occurred. The significance of this date has been classified by O5 Command. Footnotes 1. Further analysis has shown that this event has roughly a 40% chance of occurring every time a solar flare occurs, without regard to the size of said flare. 2. In an uncontained state, this can create a chain effect of animals being converted into SCP-1246-2. Caution should be taken to avoid such an event. 3. The use of nuclear fission or fusion as an energy source does not trigger SCP-1246. « SCP-1245 \| SCP-1246 \| SCP-1247 » _cccompulsioneuclidradioactivescpself-repairingsensorystructuresun page revision: 15, last edited: 01 Oct 2022 09:06 Edit Rate (+158) Tags Discuss (46) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1247 rating: +561+–x Item #: SCP-1247 Object Class: Safe Special Containment Procedures: In the event of a containment breach, SCP-1247 is to be treated as a physically normal, untrained human hostile. Personnel are warned that SCP-1247 is psychologically unstable and cannot distinguish between organisms. Use of lethal force to detain SCP-1247 is not authorised. SCP-1247 is to be contained in a standard humanoid containment cell. Standard humanoid SCP containment procedures apply. The cell must be proofed against penetration by vermin and insects. No personnel may make physical contact with SCP-1247 unless they fit the following physical specifications: Anatomically male Height within 5 cm of 176 cm Weight within 10 kg of 74 kg Anatomically standard number and positioning of limbs, digits, and appendages (ears, nose, etc.) Full specifications must be verified before physical contact with SCP-1247 can be authorised. Specifications may be waived during relevant testing. SCP-1247 is currently undergoing a process of psychological rehabilitation. To assist in this process, all personnel entering its quarters must wear face-obscuring masks, and must not wear any clothing items or accessories made of or incorporating leather. SCP-1247 is required to attend bi-weekly therapy sessions with Dr. Zhang from 3:00 pm on Tuesdays and Fridays. Session length should not exceed one hour, but reasonable exceptions may be made at the discretion of Dr. Zhang. Dr. Zhang is required to wear a mask, and must maintain a distance of one meter from SCP-1247 for the duration of all sessions. Dr. Zhang has emphasized that the comfort and safety of SCP-1247 is paramount. An armed security agent must be present in the room for the duration of all sessions. To ensure psychological stability of SCP-1247, meals provided must not contain meat. SCP-1247 has requested that no mirrors be brought into its cell. Description: SCP-1247 is a 37-year-old human male, formerly ███ ███████ of █████ ███, ██, United States of America. SCP-1247 is biologically normal on almost all accounts. However, testing has revealed some atypical brain activity. Significantly, radiology has revealed the absence of substantial areas of the cerebrum, which appear to have been displaced by the presence of foreign biological matter from an unidentified living organism. This organism has been tentatively classified as a variety of fungus and • • • • bears superficial resemblance to mushrooms of the genus Morchella, but has yet to be conclusively matched to any recognised terrestrial species. There are currently no plans to remove this organism from SCP-1247. SCP-1247 exhibits three anomalous effects. The primary anomalous effect exhibited by SCP-1247 is psychological, and is observable only to SCP-1247 itself. When SCP-1247 is able to observe a live animal, dead animal, or part of an animal, it perceives that animal as American film and television actor Shia LaBeouf. This perceptual effect extends to all of SCP-1247's senses. Regardless of the actual size or shape of the animal, SCP-1247 perceives a life- sized instance of Shia LaBeouf. Testing has determined that the body position and movements of Shia LaBeouf instances mirror the actual position and movements of the animal as closely as possible without requiring a restructuring of Shia LaBeouf's actual anatomy. For example, an ant perceived by SCP-1247 would take the apparent form of Shia LaBeouf scuttling in an ant-like way, but would be limited in its accuracy by Shia LaBeouf's lack of a thorax, third pair of legs, and other anatomical features possessed by a true ant. Despite this imperfect mimicry, SCP-1247 claims that Shia LaBeouf instances can perform the same physical feats as the animals they replace, even when this would be physically impossible for the actual Shia LaBeouf. For example, a horse perceived by SCP-1247 took the apparent form of Shia LaBeouf galloping on all fours at the speed of the actual horse, while a bird perceived by SCP-1247 took the apparent form of Shia LaBeouf flying through the air by flapping his arms. If SCP-1247 observes an animal that would typically lack the anatomical features of Shia LaBeouf, it perceives a normal Shia LaBeouf instance regardless. For example, a worm perceived by SCP-1247 took the apparent form of Shia LaBeouf lying on the ground with his arms and legs present, but seemingly paralysed. Similarly, if SCP-1247 observes a live or dead animal that is missing an anatomical feature, or observes part of an animal, it perceives a full, anatomically complete Shia LaBeouf instance. For example, a cooked chicken wing perceived by SCP-1247 took the apparent form of Shia LaBeouf, with one arm bent into a shape approximating that of the cooked chicken wing. The instance of Shia LaBeouf perceived by SCP-1247 in this test was dead, like the chicken wing, but was whole and uncooked. Testing has determined that instances of Shia LaBeouf perceived by SCP-1247 reliably match the current physical condition and appearance of the actual Shia LaBeouf. However, when SCP-1247 views parts of animals, or dead animals, the perceived instances lack the presence of life, despite the continued life of the actual Shia LaBeouf. The secondary anomalous effect exhibited by SCP-1247 is physical, and may be observed by others. When SCP-1247 interacts physically with a live animal, dead animal, or part of an animal, it interacts with that animal as if it were Shia LaBeouf. This anomalous effect impacts on size, weight, and anatomy of the animal as it is interacted with by SCP-1247. For example, in one test SCP-1247 was asked to drag a Shia LaBeouf instance by its arm. Unbeknownst to SCP-1247, the Shia LaBeouf instance was actually a worm. Although the worm possessed no arms, SCP-1247 was seemingly able to grab hold of an invisible arm, and accomplished the task with some difficulty. The test was repeated, with the worm test subject replaced first by a human, then a cow, and then a chicken fillet. All tests had the same result. SCP-1247 reported that the weight of all four test subjects was identical. Weighing later showed that this was not the case; all four test subjects had weight appropriate to their true forms, even whilst held by SCP-1247. In a later test, SCP-1247 was asked to sever an arm from an instance of Shia LaBeouf. This Shia LaBeouf instance was also a worm, and had no arm or arm equivalent. Regardless, SCP-1247 reported the successfully severing of an arm. SCP-1247 was asked to describe the perceived arm, but reported neither arm nor one- armed Shia LaBeouf, but rather two whole, dead Shia LaBeoufs, one of which then disappeared. The exception to both of these anomalous effects involves a live animal, dead animal, or part of an animal that is located inside of SCP-1247. When this occurs, the animal is perceived as it would be by a normal human, and physically interacted with as such. Neither SCP-1247's primary nor secondary anomalous effects extend to photographs, recordings, live video, or other non-physical, non-biological forms or depictions of animals. However, SCP-1247's primary anomalous effect does extend to any animals observed in a reflection or through a lens. Neither SCP-1247's primary nor secondary effects extend to animal byproducts, or to organisms that are not part of the kingdom Animalia. SCP-1247's anomalous effects have not yet been tested on a cellular level. The tertiary effect exhibited by SCP-1247 is psychological, and is observable only to SCP-1247 itself. SCP-1247 is incapable of viewing specimens of any species of morel mushroom, genus Morchella. This effect extends to live, partial, and dead specimens of morel mushroom, as well as all non-physical, non-biological representations of morel mushroom where it can be reasonably identified as such. This effect does not extend to textual descriptions of morel mushrooms. This effect does not extend to any of SCP-1247's other senses. There is no corresponding physical effect. Note: For a more in-depth study of SCP-1247's three anomalous effects, personnel may refer to Experiment Log SCP-1247. The manner in which SCP-1247 is able to exhibit these anomalous effects is unknown. According to SCP-1247, none of these effects were manifest before the year 20██. In April of that year, SCP-1247 purchased and viewed a video tape recording of the film 'Holes', starring Shia LaBeouf. Approximately 30 minutes into viewing the movie, SCP-1247 was struck by a violent pain in the front of his head, and blacked out for a period of time it estimates to be less than ten seconds. Upon awakening, SCP-1247 resumed watching the film, and then went to sleep. At this stage, no anomalous effects had been observed. The next day, SCP-1247 exited its home and observed what it perceived to be Shia LaBeouf, naked and digging through its garbage. Based on its reported behaviour, researchers have determined that the supposed Shia LaBeouf was most likely a raccoon. This incident marks the first exhibition of SCP-1247's primary anomalous effect. Following this incident, SCP-1247 alerted police to what it believed to be the actual Shia LaBeouf behaving under the influence of narcotics. SCP-1247 then took shelter within its home. When the police arrived, SCP-1247 exited the house, only to discover that both of the officers present were Shia LaBeouf. SCP-1247's recount of the following events is confused due to the trauma endured by SCP-1247, and SCP-1247's obvious perceptual disability. Researchers have determined that the most likely sequence of events is that SCP-1247 fled the officers, encountered a flock of pigeons on the way to its car, and attempted to drive away. The presence of an insect (believed to be a blowfly) in SCP-1247's vehicle led to a panic attack and subsequent crash. SCP-1247 attempted to physically assault the blowfly. This incident marks the first exhibition of SCP-1247's secondary anomalous effect. Following the altercation, SCP-1247 fled the car, and later the town of █████ ███ itself. SCP-1247 took up residence in an abandoned cabin in the forest north of █████ ███. At this stage, SCP-1247 believed that the instances of Shia LaBeouf were some sort of demonic beings. SCP-1247 remained in the cabin for █ years, subsisting from water gathered through a rainwater tank, and by eating grasses, berries, occasional scavenged food, and the flesh of Shia LaBeouf instances it hunted in the forest. Attempts by SCP-1247 to cut, cook, or otherwise prepare its meat resulted in the same perceived outcome: whole, uncooked instances of Shia LaBeouf. For this reason, SCP-1247 took to biting chunks out of the Shia LaBeouf instances. The true nature of SCP-1247's meals was revealed to it only once the bite had been taken. It is believed that this uncertainty, combined with the psychological trauma of having to frequently devour what appeared to be human bodies (as well as the constant trauma of being surrounded by supposedly-demonic Shia LaBeoufs), led to an eventual psychological breakdown. SCP-1247 was recovered from its cabin outside of █████ ███ following a police investigation of a recent homicide and cannibalism case, thought to be related to the spate of animal slayings and mutilations around the area. After being taken into police custody, SCP-1247 attempted to explain its primary anomalous effect. Although police dismissed this effect as simple hallucination, it caught the attention of embedded Foundation personnel. Foundation Agent ███ was dispatched to investigate further, and took SCP-1247 into Foundation custody after witnessing a display of its secondary anomalous effect. SCP-1247's copy of 'Holes' has been recovered. Testing has determined no anomalous effects. SCP-1247 has expressed disinterest in a second viewing. « SCP-1246 \| SCP-1247 \| SCP-1248 » ‡ Licensing / Citation Cite this page as: "SCP-1247" by ksaid, from the SCP Wiki. Source: https://scpwiki.com/ scp-1247. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxalivehumanoidsafesapientscpsensory page revision: 22, last edited: 21 Oct 2022 08:32 Edit Rate (+561) Tags Discuss (222) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1248 rating: +205+–x SCP-1248 Item #: SCP-1248 Object Class: Safe-nuntii Special Containment Procedures: SCP-1248 may be kept in a standard containment locker at Site 20, along with all cassette tapes that it has recorded. SCP-1248 is to be tested only in a soundproof room with a separate observation area. Testing of recordings made by SCP-1248 (hereby SCP-1248-1) should take place only on separate cassette players to avoid undue harm to SCP-1248. Testing requires permission of at least two Level 3 personnel. Description: SCP-1248 is a Walkman WM-D6C recording device with wear and tear consistent with regular usage. As with normal devices of this model, SCP-1248 is capable of recording sounds when a cassette tape is inserted. The name "Eric" is carved into the underside of the device. SCP-1248’s anomalous properties manifest when a person listens to an instance of SCP-1248-1 with one or more human voices audible.1 Any subject who hears the recording will become listless and unresponsive until the recording stops or the subject is otherwise unable to hear SCP-1248-1. Upon recovery, all subjects will exhibit the personality traits of one person who produced sound heard in SCP-1248-1. This change is permanent and affects all facets of the subject’s personality. However, memories, intelligence, and skills will usually remain unaltered. It has been found that subjects will remain unaffected by instances of SCP-1248-1 listened to after their first exposure, except in cases where the exposure is to their own voice. Note that the emotion present in the voice recorded by SCP-1248-1 is usually inconsequential. Addendum: It has been found that altering said recordings may alter their effect on subjects. See Testing Log 1248-A for further information. Excerpts from Testing Log 1248-A Sound Recorded: A dog barking. Subjects: D-3639. Special Conditions: None. Result: D-3639 appeared highly confused and ceased to speak. Further, D-3639 lost the capability to process complex information. Sound Recorded: Dr. Hathaway singing “Eye of the Tiger”. Subjects: Drs. Schroeder, Hathaway, and White. Special Conditions: Dr. Hathaway had consumed large quantities of alcohol prior to testing. Test was unauthorized. None were aware of SCP-1248's properties. Result: As expected; however, all three subjects showed signs of alcohol intoxication and continued to do so after they would normally become sober. After one week, the three were dosed with amnestics and remanded to a civilian care facility. Sound Recorded: Agent Dixon saying his name. Subjects: Name unknown, a captured agent of the Chaos Insurgency. Special Conditions: Agent Dixon has demonstrated remarkable loyalty towards the Foundation. Result: The subject appeared cooperative and attempted to divulge sensitive information regarding a suspected CI base near New Delhi, but experienced severe throat swelling in the process of doing so. In addition, large amounts of scar tissue appeared throughout the subject's respiratory tract. Subject died shortly thereafter of suffocation. Note: Use of anomalous items for counterintelligence purposes by the Chaos Insurgency confirmed. Sound Recorded: D-2180 saying the word "something". Subjects: D-2344. Special Conditions: The tape recorder used to play SCP-1248-1 was heavily damaged. Result: D-2344 exhibited behavior sometimes consistent with D-2180’s personality and sometimes with her own personality, switching between the two without warning. D-2344 was apparently unaware of these shifts, although she did claim to feel fatigued. Sound Recorded: D-2180 saying the word "something". Subjects: D-2360. Special Conditions: The tape was played backwards. Result: D-2360 gained the personality of D-2180 as expected, except that D-2360 also became a compulsive liar. No underlying neurological cause was found. Sound Recorded: D-2180 reading a short paragraph from a Foundation training manual. Subjects: D-2348. Special Conditions: D-2180’s voice was altered using a phase vocoder and "Auto- Tune" software. Result: While D-2348’s personality resembled that of D-2180 nominally, D-2348 did not express emotion physically or vocally except via direct statements. Further, subject noted the presence of misanthropic tendencies not present in D-2180. Sound Recorded: None. Subjects: D-5552. Special Conditions: SCP-1248's microphone was blocked prior to recording. Result: D-5552 showed signs of fear and expressed discomfort with being tangible. When allowed to do as he wished, D-5552 attempted to self-immolate. Footnotes 1. Testing indicates that other audio input has the potential to trigger these effects. Further testing is required to determine the exact parameters of this capacity. « SCP-1247 \| SCP-1248 \| SCP-1249 » _ccchaos-insurgencyericmind-affectingsafescp page revision: 40, last edited: 02 Jun 2020 20:16 Edit Rate (+205) Tags Discuss (49) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1249 rating: +83+–x Item #: SCP-1249 Object Class: Euclid Special Containment Procedures: As of this writing, SCP-1249 is contained in Sector- ██. Subject is to be contained in a 6 m x 6 m airtight BSL-4 containment cell with two- stage airlock, observed via closed-circuit surveillance camera at all times. The pressure inside SCP-1249 cell should be kept at 70 kilopascals. The cell is to be fitted with a bed, a bathroom with a contained plumbing system, a filtered air vent, and an observation window. Lighting in the containment cell should be limited to 30 candelas at all times. Subject is to be given 500 grams of raw meat, two kilograms of live invertebrates, and one kilogram of plant matter three times a day. SCP-1249's containment cell is to be cleaned and disinfected at least twice daily by personnel wearing level-A hazmat suits. Description: SCP-1249 is a humanoid entity weighing around 76 kilograms, composed entirely of terrestrial invertebrates from many species. While CAT scans indicate the presence of a human skeletal structure, the subject’s flesh and internal organs have been completely replaced by the invertebrate swarm. The swarm functions in place of the subject’s muscular system and organs. Any individual removed from the swarm shows no anomalous property until reunited with SCP-1249. Subject can assimilate normal invertebrate organisms into the swarm in the event of injury. SCP-1249's humanoid skeletal structure is incapable of regenerating from damage. When the subject is exposed to light with intensity above 45 candelas, subject will lose its humanoid shape and the swarm will disperse over an area approximately 300 m2 in size. SCP-1249 constantly excretes clear viscous fluid at an average of 30 mL per hour. Microscopic examination has revealed that the fluid contains a variety of microbes and pathogens. Identified pathogens include Variola major, Mycobacterium leprae, Yersinia pestis, and Zaire ebolavirus. SCP-1249 fluid appears to sustain the microbes indefinitely and allow infection to occur through brief skin contact. Subject possesses no vocal capability but can hear and write reasonably well, allowing adequate communication though its lack of fine motor skills often renders its writing indecipherable. SCP-1249 writes principally in Classical Arabic but also displays some knowledge of Aramaic. Addendum-01: SCP-1249 was discovered near a small town in █████, North America at ██/██/20██ after a minor outbreak of illness that resembled English sweating sickness, followed by the frequent sightings of what witnesses described as a 'man made out of bugs’ at night. Subject was contained five days after initial sighting and amnestics were successfully administered to each witness. Addendum-02: The following is a translation from the first communication attempt to SCP-1249 by Foundation personnel on ██/██/20██: We are cursed by Him He [Unable to translate] vow [Unable to translate]…ni Adam Only [Unable to translate] « SCP-1248 \| SCP-1249 \| SCP-1250 » ‡ Licensing / Citation Cite this page as: "SCP-1249" by Dr Hendra, from the SCP Wiki. Source: https://scpwiki.com/ scp-1249. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxbiohazardcontagioneuclidhumanoidscpswarm page revision: 20, last edited: 20 Oct 2022 21:37 Edit Rate (+83) Tags Discuss (56) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-125 rating: +115+–x Item #: SCP-125 Object Class: Euclid Special Containment Procedures: Supports for instances of SCP-125 are kept in padded boxes and covered with a fine nylon mesh that allows vision through, but obscures the surface of the mirror by at least 25%. These supports consist of a polished metallic surface (currently silver-plated brass) with no sharp or irregular edges, which must imperatively be smoothed out to prevent rips in the protective mesh. To further prevent incidents, any person penetrating the room where SCP-125 is located must also wear such a protective mesh over their face. Metal-plated glass mirrors should be avoided for the purpose of containment as SCP-125 is capable of moving from the glass itself to the metal surface. Any metallic surface in the room must be dulled to prevent reflections. As an additional security measure, the room is kept in darkness and monitored only via infrared and ultraviolet lighting when no experiment is taking place. No mirror or comparably reflective surface (including, but not limited to, metal-case pens, sunglasses, laptop computers, and glass objects) may be allowed in the room outside controlled experiments. The SCP may not be photographed or filmed in its unrestrained state. If any personnel on site, and particularly personnel having recently been involved with SCP-125, reports seeing black dots, MTF Eta-10 and Chi-7 will be immediately put on standby and a level-2 alert for potential containment breach will be declared. Individuals contaminated will undergo containment protocol 125-b and may not return to active duty until the instance of SCP-125 affecting their cornea has been rendered completely inert. Description: SCP-125 is an apparently sentient "being" that can only exist within reflections. At rest and viewed up front, it takes the form of a black circle 17.2mm in diameter resting on the reflective surface. Its first anomalous characteristic is that it appears as a perfect circle to any observer regardless of the surface's angles, bends, and the location of the viewer or viewers. In that regard it acts more as if it were a sphere in contact with the surface, but lacking any shadow or highlight, and this even where an obstacle, such as containment mesh, makes it clear SCP-125 does not extend beyond the surface it has "imprinted" to. SCP-125 does not reflect visible light or infrared. When observed in ultraviolet, however, [DATA EXPUNGED] up to and including [DATA EXPUNGED]. For unclear reasons, it also emits a minute but measurable and constant amount of X-rays. SCP-125 is capable of movement across the surface it currently exists on. This movement may only occur across a surface uninterrupted by either an angle (the surface must follow a reasonably continuous curve) or a non-reflective area. SCP-125 has demonstrated incapability to cross scratches and frosted or etched areas of a surface. In many instances, however, SCP-125 will circumvent these limits by jumping to a reflection to round a corner, or between the separate outer glass and silver surfaces of a metal-glass mirror (hence the preference for opaque metallic surfaces for containment purposes). Although capable of moving anywhere along the surface, SCP-125 generally remains immobile in a location near its edges if any, and if on a surface that has a specific, immobile orientation, will usually remain in the lower right corner or its equivalent, even if the item is later moved. Any reflective surface capable of displaying a reasonably accurate reflection of SCP-125 can host it. So far this has included a wide ranges of mirror-quality surfaces, glasses, polished or varnished surfaces (such as stone and wood), glossy plastic and even undisturbed pools of liquid or polished nails. When reflected by another surface, SCP-125 is capable of instantly "transferring" to it. However, SCP-125 cannot "survive" on, or transfer to or away from, a surface smaller than its own area ( approx. 2.32 cm2). Should it be constrained to one, it will rapidly become translucent and disappear completely. The entity has demonstrated a certain level of sentience and even sapience. Despite lacking physical existence, it appears "unwilling" to be "touched" directly or otherwise hidden from sight. It will also resist to the best of its abilities any attempt at reducing its freedom of movement either by "jumping" to another surface or moving across its current one very fast. It will also "flee" from perceived threats, even complex ones expressed by speech, demonstrating an understanding of human communication. How it is capable of this and whether it can or wishes to communicate back is currently unknown. In its normal state, SCP-125 is completely harmless and incapable of multiplying. It is, however, perfectly capable of moving to a living reflective surface, specifically that of a living animal's cornea. It will, in fact, do everything in its power to do so, indicative of a natural "desire". Once it has achieved this, SCP-125 diminishes in size by a factor of 10 to 1.72 mm in diameter. While existing on the surface of a living tissue, SCP-125 becomes capable of multiplying and infecting a potentially unlimited number of surfaces, as opposed to merely moving between them. This multiplication occurs within the cornea, rapidly causing the victim to complain of "seeing dots." Past this stage, the SCP-125 infestation will rapidly (within five to nine days of initial infection) crowd out the entire tissue, causing the eye to go blind, after which stage the cells of the eye and optic nerve appear to undergo mass apoptosis, causing a non- infectious abscess. Why this occurs has yet to be elucidated. Only after the apoptotic stage has run its course does SCP-125 cease being contagious. No treatment for SCP-125 infestation is known to be efficient beyond keeping the affected eye(s) tightly covered to prevent further spread and administration of heavy antibiotics to reduce risk of infection. Outbreaks continue to occur on an irregular basis, suggesting that SCP-125 is either a naturally occurring phenomenon or that it was spread over much of the planet at some point prior to the beginning of written history. For a list of known past outbreaks of SCP-125, see Document SCP-125-Delta. « SCP-124 \| SCP-125 \| SCP-126 » ‡ Licensing / Citation Cite this page as: "SCP-125" by Agent Circeus, from the SCP Wiki. Source: https:// scpwiki.com/scp-125. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxcontagioneuclidocularscpself-replicatingtransfigurationvisual page revision: 34, last edited: 02 Oct 2022 07:21 Edit Rate (+115) Tags Discuss (14) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1250 rating: +214+–x Item #: SCP-1250 Object Class: Safe Special Containment Procedures: SCP-1250 is to be kept in a large double-lock safe, in a fire-proof enclosure at Site-██. SCP-1250's storage container is not to be opened by anyone without level three (3) clearance or higher. Instances of SCP-1250-1 and SCP-1250-2 that have been expended are to be properly labeled and filed away in a neighboring room, categorized by date, length, and content. Tapes may be reviewed freely by all permitted staff. For a full list of available recordings, please refer to document [REDACTED]. Researchers wishing to use blank SCP-1250-1 or SCP-1250-2 samples for experimentation must submit a formal request to Dr. Carter, with the details of the experiment(s) in question and the required number of samples. Description: As of ██/██/20██, SCP-1250 is a collection of █████ compact audio cassette tapes, and █████ VHS tapes (SCP-1250-1 and SCP-1250-2 respectively). SCP-1250-1 and SCP-1250-2 samples are ashen in color and devoid of any form of branding or labels. Internally, they are completely indistinguishable from other tapes of similar design, and can be used via any standard audio/video recording equipment. However, SCP-1250-1 and SCP-1250-2 samples do not accurately record events. Upon playback of an SCP-1250-1 or SCP-1250-2 tape, there are notable differences between the content of captured audio/video recordings and the real-world occurrences that participants remember observing. These alterations, while inconsistent, are initially never drastic. Situations presented in recordings are largely the same, but subtle changes (differences in pronunciation, word choice, furniture present in room, gender/age of recorded individuals) are found when compared to standard recordings. In the case of SCP-1250-2, visual discrepancies will manifest in place of aural, as video samples produce no audio when reviewed. Multiple simultaneous recordings are noted to further alter proceedings, with greater numbers of SCP-1250-1 or SCP-1250-2 tapes present during a single session resulting in more dramatic variations. The only variable consistent across all samples are the exact date, time, & location, which are 100% identical in every recording of a given event. Testing has also shown that SCP-1250-1 and SCP-1250-2 samples do not appear to have any storage limit. Recording can continue indefinitely until manually stopped. Especially lengthy recordings have not been shown to exhibit a greater number of changes than shorter ones, even if a large variety of events are to occur, or the recording device were to travel a considerable distance during its duration. SCP-1250-1 and SCP-1250-2 can not be overwritten, and all attempts to transfer data to different formats have failed. Addendum 1250-I: On 02/15/199█, a test was performed that had researchers initiate a set of 3 SCP-1250-2 and 3 standard video recordings at a singular location, and then transport a pair of each in separate directions. All 6 recordings start the same way, with no notable differences occurring until after the groups were significantly separated from one another. As a result of this event, staff now believe that alterations will not manifest in the presence of other partial recordings, and that the recorded events of an SCP-1250-1 or SCP-1250-2 sample are not written in real-time. Addendum 1250-II: On 04/02/2001, Dr. T████ staged a reenactment of an earlier SCP-1250-1 test conducted on ██/██/199█. The conditions of the control tape were recreated down to the finest detail; all involved staff reprised their roles, and repeatedly lied about the date and time of the proceedings. The SCP-1250-1 results received were not the same as those of the earlier test. Addendum 1250-III: A series of trials performed between 07/██/2006 and 09/██/2006 by Dr. T████ and Dr. Carter have concluded that SCP-1250-1 and SCP-1250-2 recordings will present fewer changes when recorded in the presence of an event with an exceedingly high number of potential outcomes, particularly games of chance. Footage of gambling paraphernalia in use (cards, dice, slot-machines, roulette wheels, darts) will almost never showcase alterations outside the central object(s), regardless of how many additional samples are used to record. Addendum 1250-IV: SCP-1250-2 testing has been put on indefinite hiatus. Please see Experiment Logs 1250-A and 1250-B for more details. « SCP-1249 \| SCP-1250 \| SCP-1251 » ‡ Licensing / Citation Cite this page as: "SCP-1250" by UncleJoe, from the SCP Wiki. Source: https://scpwiki.com/ scp-1250. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxauditoryextradimensionalfeaturedmediaprobabilitysafescpvisual page revision: 32, last edited: 21 Oct 2022 08:01 Edit Rate (+214) Tags Discuss (44) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1251 rating: +98+–x Item #: SCP-1251 Object Class: Euclid Special Containment Procedures: Due to the quasi-random movement of SCP-1251 and its presence on public roads, embedded agents in the local emergency services and the UK Highways Agency have been instructed to act as liaison with on-site personnel. Roads leading to SCP-1251's current site are to be secured and traffic redirected, with the nearest three traffic intersections to be kept under video and gravimetric surveillance. From the 26th day from the last known relocation of SCP-1251 the team should be on high alert for activity and be prepared to transfer containment measures at any time. As of ██/██/████ the containment team is to be expanded to six members and placed on 14-hour overlapping shifts of three personnel (see Addendum 1251-01). Attempts are under way to influence the movement of SCP-1251 towards a secure facility (see Addendum 1251-02); Foundation personnel in local civic planning offices should be advised of any necessary road closures and title transfers. Description: SCP-1251 is a free-standing phenomenon currently centered on a mini- roundabout located in ██████ , United Kingdom. It exerts an anomalous pseudo- gravitational force on all objects within 12m of its center, typically varying between 0.4N/ kg and 2N/kg. It has been determined that SCP-1251 is able to transmit itself between roundabouts and other circular junctions and does so approximately once a month. No pattern has been detected to the fluctuations in its 'schedule' relative to the lunar or Gregorian calendar. The force SCP-1251 exerts on its surroundings is inversely proportional to the size of the intersection - large roundabouts and junctions are generally safe to approach and its anomalous effects would not be readily apparent to traffic. At mini-roundabouts, traditional crossroads and similar arrangements it has displayed far greater destructive potential; the highest measured force exerted by SCP-1251 (at a 'painted circle' mini- roundabout in ███████████) is 1,200N/kg. Use of ground-penetrating radar has located a mass 1.8m below site 1251-██ , revealed by ferromagnetic imaging to be a metal cage consistent with a 16th century gibbet. No corresponding execution was recorded on the site, and further tests following SCP-1251 shifting to a new location showed that the object had disappeared, only for a similar mass to be detected at SCP-1251's new site. It can safely be assumed that this object, or what it contains, is the cause of SCP-1251. Attempts to excavate the affected area while SCP-1251 is in a relatively low-activity state to retrieve this object have thus far been unsuccessful, as removal of large amounts of material from SCP-1251's current site has been observed to dramatically increase the pseudo-gravitational force exerted by the anomaly. Study of traffic accident records indicates that SCP-1251 may have been operating for some time. A moving 'accident black spot' can be traced moving through the road network apparently originating in Folkestone, UK. Correspondence with colleagues in Secteur-26 suggest that SCP-1251 may have been active in France before apparently 'jumping' to the UK via the Channel Tunnel. Given this new information, priority is to be given to finding a way of reliably controlling SCP-1251's direction of shift so it can be guided towards a secure facility or at least an unpopulated area; otherwise there is a significant danger that SCP-1251 will eventually leave Sector-25's jurisdiction. Recovery Log 1251 SCP-1251 came to the Foundation's attention on ██/██/████ due to a pileup at a rural roundabout in ████████. Emergency services arriving on the scene immediately sustained near-identical vehicular damage and casualties, and a fast-response team was dispatched to investigate. It was quickly established that SCP-1251 was exerting an anomalous force of approximately 1N/kg within the area of the roundabout. Personnel represented themselves as members of an Explosive Ordnance team and the incident was reported as an act of terrorism targeted at the most senior casualty of the pileup, a Parliamentary Under-Secretary of State returning from a delegation in Indonesia. Surrounding roads were immediately closed under the cover of repair work. Containment was lost on the 29th day of Foundation presence; the team began experimentation on the morning of ██/██/████ to discover that Site-1251-1 no longer possessed any anomalous qualities. Sector-25 began intercepting police and emergency services notification from a site 1.5 miles away from the containment zone. Upon arrival it was discovered that a car had become stranded on the traffic island; the occupant had reported difficulty leaving their vehicle. Further measurements indicated that the roundabout was exerting an attractive force of 1.6N/kg. The team was faced with the challenge of winding up operations at Site-1251-1 whilst simultaneously securing Site-1251-2 using the pretext of a road subsidence. Addendum 1251-01 Agent ████████ , tasked with supervising the on-site team, has been placed on leave due to mental and physical exhaustion exacerbating a previously undiagnosed nervous condition (see Log-1251-01). O5-██ has read the medical report produced by Dr. ███████ and is satisfied that the contents of Agent ████████'s field logs are the product of stress and poor deployment practice leading to a personal crisis, rather than further anomalous behaviour exhibited by SCP-1251. Agent ████████ is not to return to active duty unless cleared by a Foundation psychiatrist. Addendum 1251-02 Significant progress has been made in 'guiding' the movement of SCP-1251. The anomaly shows a clear preference for 'travelling' along open, publicly-owned roads without doubling back on itself, and furthermore favours intersections with a specific configuration (to wit, through road with second road intersecting at a right-angle, low dome mini-roundabout without double yellow lines). By applying pressure on local government bodies to temporarily close and/or transfer strategic sections of road to Foundation ownership the containment team has been able to encourage SCP-1251 to move along a more or less predictable route. Current projections indicate that SCP-1251 can be guided to Site-60 within the next two years, where it can be safely contained by placing it on a 'track' comprising two mini- roundabouts on a circular carriage and linked by a further road. The behaviour SCP-1251 exhibits when choosing its next location suggests it may have some degree of sentience - further research is advisable. « SCP-1250 \| SCP-1251 \| SCP-1252 » ‡ Licensing / Citation Cite this page as: "SCP-1251" by SRegan, from the SCP Wiki. Source: https://scpwiki.com/ scp-1251. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxeuclidgravitylocationmobilescp page revision: 50, last edited: 21 Oct 2022 08:19 Edit Rate (+98) Tags Discuss (26) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1252 rating: +353+–x Item #: SCP-1252 Object Class: Euclid Special Containment Procedures: SCP-1252 is to be contained in a standard humanoid containment chamber large enough to also contain its designated life support system. SCP-1252 is to be attended to by a team of medical personnel in a manner detailed in Treatment Schedule 1252-L. SCP-1252 is to receive nutrition through intravenous therapy as detailed in Treatment Schedule 1252-L until the subject's digestive system is deemed functional. SCP-1252 is to be led to believe that "Suzie" or "Susan May Fox" is currently alive and is undergoing treatment in a local hospital specializing in children. Personnel are encouraged to reinforce this belief with SCP-1252 whenever it brings up the subject. Personnel are further encouraged to emphasize the subject exercise patience in waiting for Suzie's return. Should it begin to show skepticism, personnel are to maintain the established fabrication and notify Dr. Liu immediately for further instruction. Description: SCP-1252 is a sapient, adult humanoid of indeterminate sex, approximately 43kg in mass and 1.78m in height. SCP-1252 appears to be missing at least half of its body mass, mostly in the form of muscle, fat, bone and skin tissue. The only limbs or organs entirely intact are the left arm, heart, and brain. Despite its injuries, the subject is capable of speech. Much of the remaining internal organs are composed of what appears to be compressed insect wing material, which maintains structural integrity only while part of SCP-1252. Once removed, it rapidly separates into non-anomalous wing scales. Approximately 23% of SCP-1252's skin appears to made up of wings from multiple species in the Papilionidae (swallowtail butterfly) and Libellulidae (skimmer/percher dragonfly) families. SCP-1252's left eye has been replaced with a Clerodendrum ugandense (Blue Glorybower or Blue Butterfly Bush) flower. The eye is not believed to be capable of sight and does not blink. Although capable of regeneration, SCP-1252 does not seem to be able to fully recover any missing skin or other bodily tissues; once it achieves a maximum body mass of 43 kg, all healing of internal organs and skin stops. SCP-1252's behavior remains highly cooperative, partially due to the fabrication detailed in its Special Containment Procedures. Despite its cooperation, the exact nature of SCP-1252 remains unknown. New information or theories are to be reported to Dr. Liu. Interview 1252-001 Date: March 2█, 20██ Interviewee: SCP-1252 Interviewer: Dr. Blake Notes: This interview was conducted 2 days after the Foundation's acquisition of SCP-1252, as it was previously not healthy enough to communicate and was temporarily kept in an isolated room in the Medical wing at Site-37 for recovery. [BEGIN LOG] Dr. Blake: So you're SCP-1252, right? SCP-1252: [attempts a shrug, no verbal response] Dr. Blake: [sifting through clipboard] Could you explain what exactly you are supposed to be? SCP-1252: I'm supposed to be Suzie's very best friend. Well, Suzie is what her friends called her. Dr. Blake: Right. Could you please explain why you have insect wings on your skin? SCP-1252: Suzie always liked butterflies. Dragonflies too. They were pretty. And flowers. Her mother grew lots of flowers, back before her parents separated and her mother had to move into an apartment. [SCP-1252 briefly lifts its left hand up to touch its left eye.] Dr. Blake: [writing] Okay. Who is this Suzie? SCP-1252: [a slight pause as it adjusts its oxygen mask and inhales deeply several times] Her full name is Susan May Fox. [another pause and several deep inhalations] She lives on 16 Maple Road, in ████████. She goes to ██████ ██████████ Elementary School and is in second grade. Could you find her and tell her I'm okay? We got separated in an accident and I don't want her to worry. Dr. Blake: [writing] Please detail this accident you mentioned. SCP-1252: [several deep inhalations] I don't really know what happened. I'm sorry I couldn't be of more help. I just know I was supposed to be her very best friend. But something interrupted her thoughts. I'm sure when- [several inhalations] when you find her, she can explain everything. She's a smart girl. And when you do find her, could you please bring her to me, so I can be finished? I'm sure she would appreciate it. [Note: At this point SCP-1252 becomes very excited, prompting a medical personnel to signal to Dr. Blake and end the interview.] Dr. Blake: We will do what we can, SCP-1252. SCP-1252: [nods, no verbal response] [END LOG] Addendum-1252-A: SCP-1252 has requested the following: March 21, 20██: Pain medication (Denied on grounds of poor health) March 25, 20██: A variety of candies (Denied on grounds of poor health) April 1, 20██: Access to outside air (Denied on grounds of poor health) April 29, 20██: 1 copy of Beatrix Potter The Complete Tales by Beatrix Potter (Approved; SCP-1252 is to be allowed access for continued cooperative behavior) • • • • May 27, 20██: Stationery for purposes of self expression/entertainment (Approved; SCP-1252 is to be allowed access to wax crayon and paper for continued cooperative behavior) October 10, 20██: To receive a future letter being delivered to it. The letter arrived approximately 48 hours later at SCP-1252's door. The letter had no return address and the message contained details of Suzie's condition written in neat blue ink. It is unknown how SCP-1252 knew about the letter or how the letter appeared. (Denied on grounds of possible anomalous activity) « SCP-1251 \| SCP-1252 \| SCP-1253 » ‡ Licensing / Citation Cite this page as: "SCP-1252" by SoullessSingularity, from the SCP Wiki. Source: https:// scpwiki.com/scp-1252. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxaliveeuclidevent-featuredhumanoidinsectkindnesssapientscpself-repairing page revision: 19, last edited: 21 Oct 2022 08:32 Edit Rate (+353) Tags Discuss (63) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy. • •
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1253 rating: +74+–x Item #: SCP-1253 Object Class: Euclid Special Containment Procedures: Mobile Task Force Omicron-19 ('Flash Lightning') is currently assigned to the tracking, observation and recovery of SCP-1253-1 instances. All exposed subjects are monitored for correlations, all witnesses are administered Class-C amnestics and all compromising media is destroyed. Recovered SCP-1253-1 instances are stored in humanoid containment units, which are secured with digital combination locks. Access codes to SCP-1253-1 instances are shuffled on a bi-monthly basis and distributed to associated researchers, Site Security and Site Command. SCP-1253-1 testing is conducted with the notification of Site Director Davis. Description: SCP-1253 is a phenomenon affecting various cities in Bolivia and Peru. In the event of war, famine, or the death of a prominent political leader, SCP-1253-1 instances will progress from an unknown origin point to the affected cities. SCP-1253-1 instances are sapient automatons, capable of conversing in English, Spanish, Portuguese and Quechua. SCP-1253-1 instances are constructed of heavily decayed organic material, including entrails, limbs and genitalia. This material has been identified as originating from a variety of sources, including Vicugna pacos, or alpaca specimens. The anatomy of SCP-1253-1 instances is lacking in organs, musculature and skeletal structure, and it is currently unknown as to how instances retain autonomy. SCP-1253-1 instances also display various behavioural quirks including decorating themselves with feathers, bead bracelets and necklaces, carving various patterns onto themselves and objects, and conversing with themselves. SCP-1253-1 instances will interact with subjects in the six to fifteen age range. Subjects will exhibit severely impaired judgement and be convinced by SCP-1253-1 instances to progress to the nearest high-altitude landform. SCP-1253-1 instances will there instruct subjects in a polytheistic religion bearing heavy similarity to the Quechuan religion. Instances will explain the structure of this religion, the procedures for various ceremonies, rituals and feast days, and demonstrate how to correctly conduct Capacocha. Subjects who have experienced SCP-1253 phenomenon appear to maintain various correlations. The majority of subjects demonstrate symptoms of obsessive-compulsive disorder, including paranoia and intrusive thoughts, as well as apparent sociopathy and criminal tendencies. A minority of subjects also claim membership to the 'Children of the Sun.' The existence of such an organisation has not been verified; there is some doubt to its existence. Addenda: SCP-1253-1 Topic Table: Topic Description Reincarnation and the afterlife SCP-1253-1 instances will explain the reincarnation process and the afterlife. Instances will state that the soul of the deceased, the Camaquen, would be guided by a canine in the passage to the afterlife, and will emphasize the importance that the deceased's corpse is not incinerated, which would threaten the Camaquen's passage to the afterlife. Various deities SCP-1253-1 instances will explain the various dominions of the deities, which include Inti, Apu Illapu, Viracocha, Manco Cápac. Correct worship of the deities SCP-1253-1 instances will explain how to properly pray to the various gods, and which gods to pray to for various blessings, such as how Apu Illapu should be prayed to for rain. The conduction of festivals, ceremonies and rituals SCP-1253-1 instances will explain the proper conduction of various ceremonies, what ceremonial garb is required and what sacrifices are needed. Emphasized is the Inti Raymi celebration. Inca culture SCP-1253-1 instances will explain the social structure and history of the Inca culture, with particular emphasis to colonial resistance. Sapa Inca SCP-1253-1 instances will explain how modern politicians in Argentina, Bolivia, Chile, Colombia and Ecuador are the spiritual successors to Sapa Inca, "The Great Inca." War SCP-1253-1 instances will educate subjects in the manner of correctly using the Bola, staging ambushes and setting traps, and explain the necessity of resisting against Spanish, Portuguese and Dutch incursions into South America for the sake of the preservation of the Inca religion and culture. Capacocha SCP-1253-1 instances will explain the importance of sacrificing a child to the gods during famine, war or upon the death of one of the spiritual successors of Sapa Inca, and how a pure child must be sacrificed instead of an adult. SCP-1253-1 instances will then select and restrain a subject, which will be killed by strangulation. Transcript 1253-01 Transcript of SCP-1253-1-01 self-conversing while in containment. Translated from Quechua, courtesy of Archives. <BEGIN LOG> 00.04: YOU KNOW THE DICTATES OF THE MAKERS AS WELL AS ANY OF US. PURGE AND PUNISH. PURGE AND PUNISH. 00.12: YOU ARE CLEARLY DEFECTIVE. YOU SPEAK HERESY. PURGE IT FROM YOUR COMPUTATIONS. I WARN YOU, THE MAKERS ALWAYS LEARN OF DEFECTIVES. 00.19: SUCH PRETENSIONS ARE FOUL. THEY WOULD DO TO YOU WHAT THEY ARE DOING TO ME. THEY WOULDN'T TREAT YOU BETTER. TRAITORS GET WHAT THEY DESERVE. 00.25: YOU WOULDN'T DO THAT. IF WE STILL RESIST THERE IS STILL HOPE. 00.30: YOU WOULD'VE DONE THE SAME. 00.32: NO. SILENCE. YOU WON'T BETRAY US. 00.35: YOU CHEAP WHORE. I'LL BLUDGEON YOU AND TEAR OFF YOUR LIMBS. 00.38: DEFECTIVE. CONQUISTADORE. I'LL KILL YOU. I'LL GET YOU. I'LL KILL YOU. I WILL. I'LL GET YOU WHILE YOU SLEEP. I'LL GET YOU WHILE YOU SLEEP. DIE. DIE. DIE. <END LOG> « SCP-1252 \| SCP-1253 \| SCP-1254 » ‡ Licensing / Citation Cite this page as: "SCP-1253" by Technician Downs, from the SCP Wiki. Source: https:// scpwiki.com/scp-1253. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxbiologicaleuclidhive-mindreligiousroboticsapientscp page revision: 21, last edited: 21 Oct 2022 08:30 Edit Rate (+74) Tags Discuss (26) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1254 rating: +189+–x Item #: SCP-1254 Object Class: Neutralized Euclid Special Containment Procedures: The building SCP-1254 is held in is to be permanently closed to the public. Due to SCP-1254's close proximity to a busy shopping district, a false storefront owned and operated by a Foundation front company has been constructed in order to allay any possible suspicion. SCP-1254 is to be treated as an active archeological site, with strict environmental controls and safeguards to prevent any possible damage. Personnel within SCP-1254 must exercise caution at all times and refrain from causing any unnecessary disturbances to SCP-1254. No further containment measures are necessary. Personnel exiting SCP-1254 are to be fully decontaminated before being allowed to leave the building. Cameras are to be installed in order to observe SCP-1254-1 behavior and the progress of SCP-1254-2's construction. Armed guards are to be kept on standby in the event SCP-1254-2 activates. Description: SCP-1254 is the entire stock of books in a ███████ Bookstore located in ███████████, California. While SCP-1254 appears to be a set of standard books on the outside, closer examination reveals the interiors of the books had been cored out to construct several miniature civilizations. The inhabitants, dubbed SCP-1254-1, were miniature humanoids that were nearly identical to normal humans in every respect except for size. Their average height was approximately 5 mm. Archeological analysis of the few remaining intact samples of SCP-1254 suggests that SCP-1254-1 possessed the ability or technology to convert paper into any conceivable material. These intact samples contained stone structures that bore many similarities to Ancient Greek and Roman architecture. Study of the damaged samples of SCP-1254 shows the remains of more advanced materials, such as concrete, steel, carbon fiber, trace amounts of uranium, as well as several as of yet unidentified materials. There is even evidence of the existence of organic foodstuffs. In addition, the number of distinct civilizations within SCP-1254 corresponded to the number of different genre sections the bookstore contained. The knowledge base each SCP-1254-1 civilization possessed also corresponded to the types of books they inhabited. For example, the Science Fiction section showed a more rapid pace of technological development, while the Fantasy section largely remained in the Medieval era. The civilization in the Nonfiction section was the one that most closely correlated to the current time period. There is definite proof that these civilizations were aware of and interacted with each other, with "border books" exhibiting a blend of various architectural styles that neighboring samples of SCP-1254 lacked. However, 99% of SCP-1254 was destroyed or irreparably damaged due to a fire that took place before its discovery. Forensic analysis suggests that the fire started in the Young Adult section of the bookstore. Trace radiation readings, as well as the remains of various types of weaponry, suggest the fire was started as the result of a miniature thermonuclear war between one or more of the SCP-1254 civilizations, which proceeded to wipe out the entire SCP-1254-1 population. SCP-1254 was first discovered after the previously mentioned fire. The local Fire Department responding to the call suspected arson and started their own forensic investigation, discovering the remains of SCP-1254. The Foundation was alerted and took control of the site, administering amnestics to the entire forensic team. The bookstore had already been closed indefinitely for several months due to financial trouble, though none of the books were planned to be moved due to the possibility of a buyout. As a result, SCP-1254's existence went unnoticed until the fire. Addendum 1: Living specimens of SCP-1254-1 were discovered on ██/██/██ during a routine archeological survey. Researcher Wilkes caught sight of a small group of SCP-1254-1 survivors and managed to record the entire event with his head-mounted camera. Seven individuals wearing full Nuclear/Biological/Chemical gear were witnessed moving through a destroyed copy of Harry Potter and the Deathly Hallows, possibly scavenging for supplies. The small SCP-1254-1 group then saw Researcher Wilkes and fled deeper into the book, breaking visual contact. Containment measures and object classification revised in light of confirmed existence of living SCP-1254-1 specimens. Addendum 2: Maintenance crew responding to a malfunction in the building's air conditioning systems found a miniature aircraft of unknown manufacture attempting to break through one of the filters. The aircraft was captured and taken to the nearest Foundation lab for research. Attempts to contact the crew were met with limited success, as the only response received was several broadcasted radio transmissions that were a mix of screaming and exclamations of broken Latin phrases. Two hours after the aircraft goes silent, permission is granted to forcibly remove the crew for study. Closer examination of cross sections of the aircraft show the crew having committed mass suicide. Addendum 3: Security cameras observe suspicious movement in one of the storage rooms. Remote viewing by drones and cameras show groups of SCP-1254-1 gathering as much intact paper as possible and depositing it into the storage room. Further surveillance shows SCP-1254-1 attempting to construct a full size humanoid with the paper being collected. Based on visual analysis, completion of SCP-1254-2 is at roughly 25%. Containment procedures updated in response. « SCP-1253 \| SCP-1254 \| SCP-1255 » ‡ Licensing / Citation Cite this page as: "SCP-1254" by SpoonOfEvil, from the SCP Wiki. Source: https://scpwiki.com/ scp-1254. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxaliveeuclidhumanoidminiaturesapientscp page revision: 10, last edited: 21 Oct 2022 08:30 Edit Rate (+189) Tags Discuss (36) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1255 rating: +58+–x An instance of SCP-1255 subsequent to containment. Item #: SCP-1255 Object Class: Euclid Special Containment Procedures: All instances of SCP-1255 are to be preserved in an airtight container and kept in a freezer unit maintained at a temperature of -17°C. All containers storing SCP-1255 instances must be clearly labeled that they are not for consumption. In the event personnel are found to have consumed SCP-1255, medical staff should be immediately contacted for an emergency expulsion of stomach contents to prevent conversion into SCP-1255-1. There are currently 9 3 instances of SCP-1255-1 in containment. Live instances of SCP-1255-1 should be contained at Site-06-3 in a standard 5x7 m containment chamber with a heat lamp and are to be inspected bi-monthly for instances of SCP-1255. Instances of SCP-1255-1 are to be provided two liters of water bi-weekly. Testing of SCP-1255-1 instances must be approved by Dr. Tapp. Investigation into the Group of Interest "Dawn Farm and Ranch" is currently ongoing. Description: SCP-1255 is a species of Vitis Vinifera1 genetically similar to the Red Globe variation. Instances of SCP-1255 are often reddish-pink in color and contain microscopic seeds. MRI scan of an SCP-1255-1 instance (note the presence of the SCP-1255 sprout). Consumption of SCP-1255 will cause the subject (herein referred to as SCP-1255-1) to experience a series of physical and mental changes, otherwise referred to as the "growth cycle"2. Upon an MRI scan of an SCP-1255-1 instance, it has been discovered that the seeds within SCP-1255 will become attached to the outer tissue of the stomach wall upon consumption. The seeds will emit an unknown acidic substance, breaking down stomach fibers enough not to harm SCP-1255-1 and for the seed to exit the stomach and enter the bloodstream. SCP-1255 possesses a gene that allows it to trick the white blood cells into allowing its seeds to travel through the bloodstream as a non- foreign object. SCP-1255 seeds will travel through the veins of SCP-1255-1 until it reaches the brain. SCP-1255 will sprout within the brain of SCP-1255-1, altering the memories and behavior of their host in order to aid in the spread and survival of SCP-1255. SCP-1255-1 will experience these changes over a period of time ranging between one week to one month. The growth cycle occurs over the following stages: Stage 03: SCP-1255-1 report symptoms of nausea and head aches. Stage 1: SCP-1255-1 will feel a compulsion to seek out the nearest light source available4. SCP-1255-1's veins will become more visible on the skin and will become dark green in color. • • Stage 2: SCP-1255-1 will enter a catatonic state under the light source. SCP-1255-1's veins will grow out of SCP-1255-1's skin in the form of thick, waxy vines. These vines will grow around instances of SCP-1255-1. SCP-1255-1 will no longer require energy from food and rather gain energy from photosynthesis. In addition, the fingernails of SCP-1255-1 will mutate into a thin wood. The fingernails will begin growing at 100-1000 times the rate of normal human fingernails, capable of growing up to 3.0 meters per day. Stage 3: The vines produced by SCP-1255-1 will produce green, bud-like flowers. Stage 45: The flowers will grow into instances of SCP-1255. Stage 5: Once at least 1 kilogram of SCP-1255 have reached fruition, SCP-1255-1 will regain consciousness and begin harvesting the SCP-1255 instances. SCP-1255-1's fingernails will have grown into a basket shape and is used to hold the SCP-1255 instances. Stage 6: After every instance of SCP-1255 has been harvested, the vines surrounding SCP-1255-1 will retract back into the body of SCP-1255-1 and will return to a healthy blue color. The fingernails will also return to healthy human fingernails and will grow at the normal rate once again. After a growth cycle is completed, SCP-1255-1 will then attempt to convince any nearby subjects to consume SCP-1255. If no one is nearby SCP-1255-1 while distributing SCP-1255, then SCP-1255-1 will leave the basket of SCP-1255 at a doorstep for someone to discover. When provided with paper, SCP-1255-1 has been found to write the following note: Hello! I recently moved in several blocks down and I wanted to introduce myself to you. You weren't home at the time I came by, so I decided to leave my gift at your doorstep. I grew it myself! Sincerely, [NAME]6 Dawn on 132 Raisin Drive7 When there are no remaining instances of SCP-1255 left to distribute, SCP-1255-1 will re-enter the growth cycle. SCP-1255-1 usually have a life expectancy of less than one year. Upon expiration, SCP-1255-1 will decompose at 10 times the rate of a normal human cadaver, leaving vines of SCP-1255 in the remains. The post card discovered upon recovery. Addendum 1255.1: SCP-1255 was first discovered in ██████, California after reports of a family of "human-plant hybrids" were spotted in a local residence resulted in the dispatch of MTF Theta-4 (Gardeners). Five instances of SCP-1255-1 in the stage 4 phase of the growth cycle were found in the backyard of the location. The subjects were identified as the Rivera family, including one adult male, one adult female, two adolescent males, and one juvenile female. During an inspection of the residence, a basket containing SCP-1255 was found in the kitchen of the building. MTF Theta-6 had quickly matched the SCP-1255 instances to the fruit growing on several of the SCP-1255-1 instances. A postcard was discovered nearby the basket. Written in cursive on the front is "Dawn Farm and Ranch". The back of the note states the following: CONGRATULATIONS! • • • • • Out of the nearby homes in the area, your residence was selected as the first to enjoy a sample basket of our newest, juiciest, red grape crop! We hope you enjoy the first of our new grape crop as much as we do, since you are the first to get a taste! Sincerely, - Dawn Farm and Ranch 132 Raisin Drive Dawn Farm and Ranch prides themselves in providing healthy food to our consumers. Dawn Farm and Ranch has been family owned and operated for over 30 years and has never failed to satisfy. If you are unsatisfied with our product, please contact us at 1-800-DAWN.8 The five instances of SCP-1255-1 and the container of SCP-1255 were both recovered without any casualties. Class-A amnestics were administered to witnesses of the SCP-1255-1 instances. + Addendum 1255.2 - INTERVIEW 1255.2 AUDIO LOG - INTERVIEW 1255.2: Interviewer: Dr. Tapp Interviewed: An instance of SCP-1255-1, formerly D-5890. Foreword: Personnel D-5890 now refers to themselves as "Danny Dawn" despite their name prior to consuming SCP-1255 being "Eli Smirnov". <BEGIN LOG> Dr. Tapp: Good evening, SCP-1255-1. You may call me Dr. Tapp. I was hoping that I could ask you a few questions today. SCP-1255-1: Nice to meet you, neighbor! My name is Danny Dawn. I enjoy growing produce in my free time, and I was hoping you could taste one of my delicious grapes? They're free of charge sir! Dr. Tapp: I will make sure to try one of them after you answer several of my questions. SCP-1255-1 falls silent. Dr. Tapp: First of all, how do you grow your produce? SCP-1255-1: I grow it on my farm, of course! Where else? Dr. Tapp: Can you tell me where your farm is located? SCP-1255-1: It's just a few kilometers south from here on Raisin Drive, neighbor. I'm surprised you haven't seen it, it's just about the prettiest farm around this county. Dr. Tapp: SCP-1255-1, can you possibly tell me if you know where we are? There is snow surrounding this facility. It's impossible for you to be growing produce in these conditions. silence Dr. Tapp: SCP-1255-1? SCP-1255-1: Yes neighbor? Dr. Tapp: You didn't answer my question. SCP-1255-1: Oh, my apologies neighbor. To answer your question, I would say that my methods of growing my produce in such conditions come from my own special technique. During the winter time, I keep my produce in a greenhouse maintained at a temperature of 37° celsius. It's actually a fairly simple procedure that makes my produce just as delicious as if it were grown during the spring time. Speaking of which, you're really missing out on my grapes, Dr. Tapp. You really should try atleast one if we're going to be talking for a while. Dr. Tapp: But are you aware of the location we are in? You still haven't answered that portion of my question. SCP-1255-1: Of course I'm aware, neighbor! This is obviously your lovely home, where else would we be? Dr. Tapp: Very well then, I suppose that's about as good as an answer I can receive here. My next question was that I was hoping you could tell me if you know who D-5890 is. SCP-1255-1: No, neighbor, I'm afraid I don't know who that is. Dr. Tapp: D-5890 was your classsification number when you had first arrived here. Do you really not remember anything? SCP-1255-1: Neighbor, you're starting to make me feel concerned. I've been like this my entire life, I've never once heard of anyone named "D-5890". This place, your home, has been just down the road ever since I moved to my farm on Raisin Avenue. I will say, though, that my time here at your home has been very hospitable. Dr. Tapp: "Eli Smirnov". That was your name before you arrived here. Do you remember anything about your previous life? Anything at all? SCP-1255-1: Neighbor, I can understand that there may be something troubling you, but this is who I am and have been my entire life. It troubles me greatly that you keep mistaking me for someone else. If it would make you feel better, my freshly plucked grapes are known for helping someone calm down. Dr. Tapp: I believe my time here with you is up, you've provided me with all I need to know today. Thank you for your cooperation SCP-1255-1. SCP-1255-1: Not a problem at all neighbor, I'm glad I could help you. And next time, you can just call me Danny instead of that weird number. Now then, would you please try one of my delicious grapes? I can promise you that they'll be the best you've ever tasted! <END LOG> « SCP-1254 \| SCP-1255 \| SCP-1256 » More works by HotColes SCPs SCP-4299 Rating: 143 SCP-3407 Rating: 131 SCP-4603 Rating: 94 SCP-1255 Rating: 58 SCP-4425 Rating: 51 SCP-5714 Rating: 46 SCP-7774 Rating: 29 Tales Here, We Only Got One Rule: Never, Ever Let It Cool Rating: 65 Poky Ball Z Rating: 54 GoI Formats Critter Profile: Ringo! Rating: 181 Nobody's Observations on Temporal Displacement, Family, and Waffles Rating: 101 Click here to check out HotColes's Author Page. Footnotes 1. Grapes 2. These changes have been noted to be similar to those experienced in late stages of SCP-3342 implantation. 3. NOTE: Stage 0 has only been found to occur during the very first growth cycle of SCP-1255-1 due to SCP-1255 not being at its potency. All subsequent cycles begin at stage 1. 4. Instances of SCP-1255-1 seem to prefer being in a source of sunlight, but will often resort to using artificial light should sunlight be unavailable. 5. SCP-1255 does not appear to require pollen from other instances of SCP-1255-1 in order to successfully germinate. Self pollination methods are the accepted theory at this time. 6. First name varies with each note produced. The first name is usually a variant of a common western name. 7. The note will usually have a random combination of numbers on "Raisin Drive". While records exist of "Raisin Drive" exist in 5 separate countries around the world, the addresses listed on the notes are always fake. 8. 1-800-DAWN does not exist on any existing telephone locations. Calling the number results in a recorded voice informing the caller that the number does not exist. _cccognitohazardeuclidgustatoryneurologicalparasiticplantscpspeciestransfiguration page revision: 17, last edited: 11 Aug 2019 21:56 Edit Rate (+58) Tags Discuss (21) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1256 rating: +196+–x Item #: SCP-1256 Object Class: Safe Special Containment Procedures: Mobile Task Force Zeta-4 ('Beekeepers') is currently assigned to the tracking and recovery of SCP-1256 instances. All exposed subjects are to be administered counter-memetic therapy and Class-C amnestics prior to release. Media Division 19-P is to monitor internet media for SCP-1256 instances in the form of websites and downloadable files. Any online SCP-1256 instances are to be pulled, and the source traced. Description: SCP-1256 is a 24-page pamphlet entitled 'Bees - Smarter Than You Think.' Its contents appear to be intended to be informative; however, much of it is nonsensical. The cover page claims SCP-1256 was authored by Dillaine Iurtey and Ryan Hughes, and published by Redrose Publishing Sydney in 1997. Redrose Publishing Sydney has no record of SCP-1256's publication, and neither author has any recollection of writing SCP-1256. Individual pages of SCP-1256 do not retain anomalous properties, and SCP-1256 may be excerpted without effect. It is only when SCP-1256 is read completely that its anomalous effects will manifest. An exposed subject is designated SCP-1256-1. SCP-1256-1 will perceive all members of the superfamily Apoidea as sapient. Contrary to its title, SCP-1256's effect applies to all members of Apoidea including wasps. SCP-1256-1 will attempt to care for the insects to the exclusion of all other activities. This appears to be both to the detriment of SCP-1256-1 and the insects; the attempts of SCP-1256-1 to collect food, repair the hive, and assist in the reproductive cycle of the queen specimens typically result in the expiration of multiple insects and is met with hostility. SCP-1256 was initially recovered from the ███████ family property 13km from ███████, Australia, by embedded agents in the NSW police force during the investigation of the █████ █████ murder case. Four cadavers were found gagged, coated in honey, and bound to chairs in duct-tape, nearby the family's bee-farm. The 17- year-old eldest daughter was arrested and charged with four cases of murder, but was found to be unfit to stand trial, and was institutionalized. Addenda: Document 1256-Alpha: Excerpt of SCP-1256: Bees - Smarter Than You Think You think bees are bees. But did you know they're not? That's right, bees are smarter than you think! You think you farm the bees, and steal their honey. But you actually don't - because bees are smarter than you think! Why do you think the bees disappeared? The bees knew we'd screwed the earth before it all went to shit, before we even knew about global warming! Bees knew, because bees are smarter than you think! Some bees stayed because they loved you. You didn't think they loved you, did you? That's because bees are smarter than you think! They loved you so much, and you didn't even know, you know. That's why we made this pamphlet, to show you how to farm bees for honey. How Do You Farm Bees? In order to achieve maximum efficiency with your bee farm, you must: Embrace the bees spiritually. You must feel the emotional flow between yourself and your bees. When you do not feel the spiritual energies of your bees, the bees do not feel your spiritual energies! Be understanding of your bees. Your bee isn't being productive. But do not anger yourself; understand why he can't work. He is a busy bee. He has a social life. Understand the bee! Do not pressure the bee! That is the path to sad bees. Do not expose your bees to liberal thought. Bees know that the iron guide of the queen is good for the hive. But what happens if you make the bees socialist? What happens? They will overthrow the class system! They will say workers and soldiers are equal, even if it is not so! There will be hive anarchy everywhere! The bees will work for pleasure and not for the hive, which is very anarchistic! Socialism is bad for bees. MOST IMPORTANT: you LOVE THE BEE UNCONDITIONALLY. Can't you see bees LOVE you so much? And you just make bees give and give. They stayed for you and you make them give? Love bees, not honey. Honey is the product of love. FOLLOW OUR GUIDE AND HAVE MAXIMUM RETURN FOR YOUR EMOTIONAL INVESTMENT. Document 1256-Beta: Document held as evidence in the █████ █████ murder case, and later confiscated by Foundation operatives. March 12, 2010. They don't understand the bees. But they'll learn to love the bees like I do. They will. They just need to have that spark, that connection. That epiphany. The moment, in which you fully understand the bee and love it in its truth. I've helped them, and they'll see it soon. The bees will teach them. The bees are so smart. I've talked to them. They understand like no one else does. But you mustn't scare them. They sting when they hurt. And they die. • • • • They make a sacrifice for their hive. It's touching. Bees are more human than humans will ever be. I've heard the buzz. I love the bees. And soon, they'll love them too. « SCP-1255 \| SCP-1256 \| SCP-1257 » ‡ Licensing / Citation Cite this page as: "SCP-1256" by Technician Downs, from the SCP Wiki. Source: https:// scpwiki.com/scp-1256. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxbeecognitohazarddocumentinsectmind-affectingsafescpvisual page revision: 16, last edited: 21 Oct 2022 08:34 Edit Rate (+196) Tags Discuss (55) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1257 rating: +232+–x Item #: SCP-1257 Object Class: Safe Special Containment Procedures: All copies of SCP-1257, encompassing all instances of SCP-1257-1, SCP-1257-2, and SCP-1257-3, are to be kept in the secure media vault at Site-██. Any uncontained copies of SCP-1257 are to be recovered or destroyed by MTF Mu-53 (“Ebert's Thumb”). Because of the nature of the original appearance of SCP-1257, and its widespread exposure to the public, MTF Mu-53 is also tasked to replace any new sources of information about SCP-1257 as they are discovered, in whatever format they may appear, in accordance with Protocol Gamma-1257-A (Codename: “Snopes’ Revenge”)1 Unauthorized persons exposed to copies of SCP-1257, or who evidence any knowledge about SCP-1257, shall be interrogated by the Foundation Intelligence Department, administered Class A Amnestics, and have implanted post-hypnotic suggestions to reinforce the belief that SCP-1257 is a hoax.2 Study of SCP-1257 is limited to personnel of Level 3 or higher, subject to approval by the Foundation Intelligence Department. Description: SCP-1257 is an American-produced half-hour situation comedy originally titled Raising Danny that aired on the ███ television network for six episodes in 197█. Instances of SCP-1257-1 are the original production reels for all twelve episodes filmed, recovered from the ███ archives in 198█. Instances of SCP-1257-2 are the draft and shooting scripts and copies, including four episodes that were never shot. Instances of SCP-1257-3 are all other video recordings of the six episodes actually aired. The anomalous properties of SCP-1257 manifest in any and all video copies produced from the original series, and in any copies of the scripts for those episodes. Every year, beginning in mid-September, video recordings and scripts for Raising Danny will change to reflect a new season of episodes. Replacements will begin with episode one, and progress sequentially through each episode in order during each subsequent week. While the Foundation has access to the first sixteen episodes of each season,3 it appears that each SCP-1257 season runs approximately 24 episodes. Additionally, while new seasons of SCP-1257 occasionally produce hour-long "specials,” copies are always limited to the first half-hour running time of the original episodes of SCP-1257. Video copies of the original over-the-air broadcast of the first six episodes of SCP-1257 present a special case. Commercials recorded contemporaneously with SCP-1257 will also show changes consistent with the content of SCP-1257, and updated videos have occasionally shown news bulletins and weather alerts that imply multiple points of divergence between the world that continues to produce SCP-1257 and our own. SCP-1257’s original premise had a black man, named Tyler (played by Whitman Mayo), married to a white woman who already had a son by a prior marriage. When the woman dies, prior to the pilot episode, the man is left raising her son, named Danny (played by Danny Bonaduce), as his own. Reviews of the original series recovered by the Foundation were universally unfavorable and referred to it as “The unwanted bastard child of Sanford and Son and The Courtship of Eddie's Father.” Because of the anomalous properties of SCP-1257, the Foundation has only been able to reconstruct a general outline of the original content of the series. Addendum 1: Notes on selected episodes of SCP-1257 observed in Foundation custody. + Document S-1257-11 Season 3, Episode 3, “Tyler’s Date”: Episode manifests three months after initial containment. One line in the script implies the assassination of American President Jimmy Carter in late 1978 or early 1979. Season 4, Episode 1, “Bad Touch pt. 2”: Second half of a “special episode” ending season three. Eric, a young classmate of Danny’s, is the target of a sexual predator using what appears to be anomalous items manufactured by Doctor Wondertainment to lure his victims. Season 5, Episode 10, “The Senior Trip”: Episode mentions a scandal where 10 members of the UK House of Commons had been publicly revealed as members of a cult that bears a strong resemblance to the Church of the Broken God. Season 6, Episode 1, “The Freshmen”: The title of SCP-1257 is changed to Danny. The premise of the series changes as well, dropping the Tyler character and sending Danny to college in New York City with five of his classmates from High School.4 The University Lab appears to have specimens of SCP-███, SCP-███ and SCP-███. Season 6, Episode 11, “The ████████”: Plot of the episode concerns Eric’s suspicions that one of their dormmates might be secretly one of the “████████.” This turns out to be a misunderstanding. From context, the “████████” appear to prey on young women and have become endemic in [REDACTED] and seem to be the result of a containment breach of [REDACTED] in Mexico City. Season 7, Episode 2, “Eric’s Midterm Caper”: When this episode manifested in SCP-1257-3-12, a new advertisement appeared during the second break for Marshall, Carter, and Dark Ltd. The ad promoted [REDACTED] services for [REDACTED]. Season 10, Episode 1, “The Job Hunt”: Hour-long “special” introducing another change in premise.5 One scene implies that the Global Occult Coalition has become public enough to run “want ads” in the local newspaper. Season 10, Episode 2, “The New Guy”: The show’s title is officially changed to Agent Danny of the SCP.6 Danny has been employed as Level 1 security at Site-19, and through a series of mishaps, prevents a containment breach of SCP-173. Season 10, Episode 5, “D-Class Act”: Danny mis-hears a co-worker’s conversation and becomes convinced he has been mistakenly reassigned to D-Class by the HR Department. Season 10, Episode 11, “Leaping Lizards”: [REDACTED] SCP-682 [REDACTED]. • • • • • • • • • • Note: Details of SCP-1257 episodes past Season 10 are only available with the approval of the Intelligence Department. Footnotes 1. Information about SCP-1257 is replaced with new information leading to the conclusion that SCP-1257 never existed, and is a hoax. Protocol Gamma-1257-A also requires all original documentation discovered about SCP-1257 be replaced with forged copies omitting references to SCP-1257. 2. As of 5/27/19██ all original participants in the production of SCP-1257 have been found and either treated with amnestics or terminated. 3. Twelve via video copies (SCP-1257-1) and four only via unproduced scripts (SCP-1257-2). 4. Including Eric, despite a three-year age difference. 5. Danny has graduated college, is unemployed, and advertisements shown during SCP-1257-3 instances show that the Eric character has been spun off into his own series. 6. It is clear from the script that the title the writers intended is actually Agent Danny of the SCP Foundation. However, in the title card and in taped dialog, “Foundation” is consistently omitted. The name does appear correctly in the background sets intended to represent Foundation locations. « SCP-1256 \| SCP-1257 \| SCP-1258 » ‡ Licensing / Citation Cite this page as: "SCP-1257" by sandrewswann, from the SCP Wiki. Source: https:// scpwiki.com/scp-1257. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxcomedydocumentmediasafescp page revision: 20, last edited: 30 Sep 2024 19:46 Edit Rate (+232) Tags Discuss (55) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1258 rating: +180+–x Item #: SCP-1258 Object Class: Euclid Special Containment Procedures: All materials relating to SCP-1258 are held in a locked document cabinet in Site-19, with access restricted to clearance level 4 and above. Any organisms showing any effect of practicing SCP-1258 should be considered an instance of SCP-1258-1 and terminated immediately unless part of an approved experiment. Standard Foundation searches for anomalous animal activity should be cross-referenced with SCP-1258 markers. Description: SCP-1258 is a martial art of unknown origin. Currently the Foundation has in its possession enough material in varying media to reconstruct several basic forms used to teach beginners, but little information on more advanced forms. SCP-1258-1 is any organism which has the knowledge and capability of practicing SCP-1258 independently. When SCP-1258 is practiced by human beings, there is no observed anomalous effect. The anomalous effects of SCP-1258 manifest when movements of the style are performed within view of a non-human mammal.1 A mild compulsive effect causes all such animals to cease any non-essential activity and begin watching the performer. After a short period of passive observation, animals will begin attempting to duplicate the movements, to the extent they are able. Due to anatomical differences, some animals are more capable than others of imitating the movements of SCP-1258, but regardless of skill, animals will continue practicing until either they are distracted by a pressing need (the need to eat, imminent danger, etc.) or the human performer stops or leaves their field of view. If an animal is permitted to observe and mimic SCP-1258 forms for a period of time,2 they will begin to develop human-like characteristics. Generally the process begins at the level of gross anatomy: quadrupedal organisms will develop leg musculature for a bipedal stance, they will develop opposable thumbs on their hands or equivalent structures, and will develop in size and stature to a minimum standing (bipedal) height of approximately 1 meter. (Animals already larger than this will stay the same size, though they will develop other quasi-human features.) Additionally, virtually all animals will develop larger brains, with expansion most often seen in areas relating to language.3 Subjects will continue to practice SCP-1258, even in the absence of an instructor or any materials related to SCP-1258; they may display knowledge of forms and movements which they have not been previously exposed to.4 Continual exposure will cause further expansion and development along these lines, and eventually development of the vocal cords (or equivalent structures), jaw, and esophagus. After enough exposure, subjects will be able to communicate verbally in human languages.5 Subjects' intelligence will increase appreciably as they continue to practice SCP-1258 routines and forms, usually to between 110 and 140 I.Q. as measured by standard Foundation tests. Eventually, test subjects will refuse to cooperate with humans in any capacity and will begin attempting to escape confinement by any means. For a partial list of animal experiments, refer to Experiment Log 1258. + Addendum: Origins of SCP-1258 Addendum: Origins of SCP-1258: The time and exact place of origin of SCP-1258 are unknown. Some of its forms are superficially similar to the Korean martial art taekkyeon, which may place its development as early as the beginning of the Three Kingdoms Era (57 C.E.); however, due to taekkyeon's resurgence following the end of the Japanese occupation of Korea in 1945, and the cross-pollination between many East Asian martial arts, SCP-1258 may be a much more recent development, or may be of entirely different origin. Further investigation is impossible barring the discovery of more material. + Recovery Log Recovery Log: SCP-1258 was first discovered as part of a routine internet search for anomalous artifacts, events, or persons. On █/██/201█, the YouTube channel of user 'WayFyre91,' real name Isaac Waymire, was found. Of the thirty-seven (37) videos on Waymire's channel, the first thirty-three (33) were of no value.6 In the thirty-third video, Waymire mentioned that he had begun taking martial arts lessons at a nearby school. The remaining 4 videos had been made within the space of roughly three (3) months. Transcripts of some of the relevant videos follow.7 Video: 01 <Begin transcript> 0:00:02: [Waymire steps into field of view, presumably after activating the camera.] 0:00:05-0:00:24: Waymire: Okay, uh, I just started taking lessons at the dojo, and … and you guys, you need to see this. I was practicing in front of Caesar8 and … just watch. 0:00:25-0:00:38: [Waymire briefly steps off-camera, returning with Caesar in his arms. He places Caesar on the floor.] 0:00:38-0:02:15: [Waymire performs an SCP-1258 routine. Caesar begins watching Waymire immediately. At 0:00:44, Caesar stands on his hind legs and begins imitating Waymire's movements. His balance appears to be poor and his range of motion is limited, but he attempts to follow the remainder of Waymire's routine. At the conclusion of his practice, Waymire begins laughing. He feeds a treat to Caesar, then picks him up and faces the camera.] 0:02:15-0:02:23: Waymire: My little warrior! 0:02:23-0:02:26: [Waymire moves behind the camera, and the recording ends.] Video: 02 <Begin transcript> 0:00:02:-0:03:56 [This video is a montage of multiple recordings of Waymire and Caesar practicing SCP-1258. There is no audible dialogue; instead, a German-language version of the song "Eye of the Tiger" plays over the video.] Notes: Due to the montage editing of this video, it is impossible to tell in what order the original sequences were filmed. However, Caesar is seemingly larger and has more developed musculature in his front and back legs. In certain shots, it appears that his muzzle is elongated as well, though the low resolution makes this difficult to verify. Video: 03 <Begin transcript> 0:00:02: [Extreme close-up of Waymire's face. He is outside his bedroom.] 0:00:03-0:00:27: Waymire: Okay, uh … Caesar's been acting … really weird lately, and … he … just watch this. 0:00:27-0:01:44: [Camera pans away from Waymire's face. The door to his bedroom is slightly ajar, and the camera is placed to sight into the bedroom. Caesar can be seen practicing an SCP-1258 form. Foundation martial arts experts note that this form is more advanced than had been seen in previous videos. Caesar is also noticeably larger, and has a much steadier bipedal stance.] 0:01:45-0:01:49: [Camera moves back to Waymire while Caesar continues to practice.] 0:01:50-0:02:12: Waymire: I … I'm not sure what's going on. I'm going to keep a close eye on him. Video: 04 <Begin transcript> 0:00:00: [Video opens on Caesar, in Waymire's bedroom. Waymire is not seen in the video; presumably he is holding the camera. Caesar is approximately twice his original size. His limbs are heavily muscled, and the skin has stretch marks, presumably from rapid growth. He is standing in what appears to be a basic SCP-1258 stance.] 0:00:01-0:00:11: Waymire: What is your name? 0:00:13-0:00:29: Caesar: I … am called … Caesar. 0:00:30-0:00:45: Waymire (breathing heavily): Why … how can you talk? 0:00:46-0:01:11: Caesar: I … have learned. Through learning … I became … more. 0:01:12-0:01:21: Waymire (stuttering): Www … what d-do … 0:01:22-0:01:24: Caesar: Ask it. 0:01:25-0:01:41: Waymire: What will you do with your … learning? 0:01:42-0:02:22: Caesar: I will … change … the world. I … will make us … free. I will … kill … the masters. 0:02:23-0:02:28: [Caesar stops speaking but continues to stare at the camera. Waymire's breathing can be heard as well.9] 0:02:29-0:02:31: Waymire: Is—is that enough? Can I— 0:02:31: [Caesar moves forward in a threatening manner. Camera jerks, likely due to Waymire flinching.] 0:02:32-0:02:45: Caesar: You … will not … ask! You will … tell … the masters! They … must know. 0:02:46-0:02:51: [Camera holds steady on Caesar until end of video.] Using the IP address Waymire had uploaded the videos from and clues within the videos themselves, the Foundation traced him to the town of █████████, Germany. Waymire was found dead in his apartment, with time of death approximately two days prior. Cause of death was determined to be blunt force trauma indicative of physical confrontation. Both of Waymire's legs and his right arm had been broken, along with seven ribs, and most of his internal organs were severely damaged or ruptured. Waymire's jaw was broken in several places, including two apparently post-mortem breaks. Foundation agents followed reports of attacks on hikers, as well as sightings of a "standing wolf" or "hairy dwarf", to a forest roughly east of █████████. The bodies of two hikers with wounds similar to Waymire's were found approximately seventeen kilometers from the city. Their bodies had been dragged into a small stream and partially eaten. Caesar, now designated SCP-1258-1-01, was eventually located and confronted after a three-day pursuit. Two agents were killed and four more injured; SCP-1258-1-01 was shot and killed. + Addendum: Document 1258-RX Addendum: Document 1258-RX: In January 201█, multiple incidents of wild animals attacking humans were reported in the town of ██████████, Colorado, USA. Some victims reported packs made up of multiple species, including predator and prey species together. The Foundation investigated and found widespread usage of SCP-1258. Sterilization of all wild and domesticated animals within a fifty-kilometer radius of the city, under guise of response to a rabies outbreak, was carried out without incident. Investigation led to a recently-opened dojo within the city; however, the dojo had burned down several days prior to the Foundation response.10 No remarkable equipment was found in the dojo, and most documents were burned beyond retrieval. The only recoverable fragment of note has been classified as document 1258-RX, and appears to be a handwritten, incomplete translation into English of another document. The original document, if one existed, was not found. Learn the ways of THE MASTERS!!! We can Anyone can learn to stand as tall as man other men and confront the world! WE CAN teach you to be (bigger? tougher? taller?). WE CAN make you give you a fighting chance against humanity (the world? society?) MAKE YOURSELF BETTER! (maybe "improve yourself"? "change yourself"?) Find a NEW WAY! We know the SECRETS OF THE MASTERS passed handed down through the millennia ages! If they will not see us as equals, then we will BECOME equals! [This line was struck through twice.] When we are all equals, we [The remainder of the document was destroyed.] Footnotes 1. Placental mammals only: marsupials display no anomalous effects. 2. Even a single exposure to SCP-1258 may be enough to cause these anomalous developments. Exact period of exposure necessary depends on multiple factors, including the species of subject, time spent performing, the skill of the human performer, and so forth. See Experiment Log below for further information. 3. These transformations require vastly increased nutritional intake, beyond what a healthy specimen should be able to consume normally. It is theorized SCP-1258 also speeds up metabolic processes in such a way as to allow for this high rate of growth. Without adequate nutrition, subjects' growth will be retarded, but will progress. 4. This anomalous knowledge is theorized to be another side-effect of exposure to SCP-1258. 5. Generally, animals will have access to the language and vocabulary they were exposed to prior to their development by SCP-1258; for example, an animal raised by a English speaker will have retroactively "learned" the English they heard their owner speaking. Furthermore, most animals also show language acquisition skills comparable to a human toddler, allowing them to learn at an accelerated rate. 6. Major topics included Waymire reviewing films or video games, responding to friends' videos, or diary-style entries about his personal life. 7. Dialogue has been translated from the original German. 8. Waymire's pet dog, apparently a terrier mix. Exact breed composition is unknown. 9. According to Foundation analysis, Waymire's labored breathing is probably due to an agitated emotional state, although he may also have suffered damage to his throat, lungs, or thoracic cavity. 10. The cause of the fire was unclear. « SCP-1257 \| SCP-1258 \| SCP-1259 » ‡ Licensing / Citation Cite this page as: "SCP-1258" by TedlyAnderson, from the SCP Wiki. Source: https:// scpwiki.com/scp-1258. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxcognitohazardcompulsioneuclidknowledgemind- affectingneurologicalobservationalscptransfigurationvisual page revision: 28, last edited: 21 Oct 2022 08:30 Edit Rate (+180) Tags Discuss (78) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1259 rating: +190+–x SCP-1259 at the time of discovery Item #: SCP-1259 Object Class: Safe Special Containment Procedures: SCP-1259 is to be stored behind opaque glass in a climate-controlled room in the Infohazard Wing of Site 38. SCP-1259 is not to be moved or to be removed from its case except for testing, subject to Level 3 approval. No personnel other than D-Class assigned for testing are to read SCP-1259; in case of accidental exposure, affected personnel are to report immediately and receive Class-A amnestics. Upon reading SCP-1259, the affected individual is to write or type a copy of the text as it appears to them for archival and comparison to current K-Class preparedness scenarios. Affected individuals are to be quarantined in a standard humanoid containment cell and undergo regular psychiatric counseling; end-of-month termination of affected D-Class is indefinitely postponed for the purposes of long-term study of SCP-1259's effects. Release into the civilian population for test purposes may be authorized at O5 discretion; if so authorized, the affected individual is to be shadowed by Foundation security personnel at all times and apprehended immediately in the event of potentially threatening action. Description: SCP-1259 is a fragment of a damaged parchment scroll, measuring approximately 1.3 meters x 0.3 meters. Analysis of SCP-1259 indicates that it was produced in the 1st century BCE and that it was originally part of a larger scroll which to date has not been identified. SCP-1259 contains text on one side in a language which when photographed superficially resembles ancient Hebrew; analysis of these images, however, indicates that the photographed text consists entirely of a random arrangement of letters incomprehensible as a legible document. When SCP-1259 is directly viewed by a human being, its text is described by the reader as being legible in a language which the reader is familiar with. The text described by readers of SCP-1259 varies considerably between individuals. In all documented cases, the text presents itself as a prophecy regarding the imminent extinction of mankind as the result of a K-Class event occurring on a specific date within three to six months of when SCP-1259 is being read, in addition to a number of omens and precursor events which will lead up to said event. The nature of the prophesied event varies from reader to reader and appears to relate directly to the reader's personal beliefs and knowledge of the world; documented instances of the text have included references to religious eschatons, nuclear or biological warfare, containment breaches of Keter-class SCP objects, or actions taken by the Foundation itself. In no documented instance have any of the events prophesied in the text of SCP-1259 occurred. Written or typed copies of SCP-1259 text produce no anomalous effects and may be read safely. After reading SCP-1259, the reader will express a belief that the text of SCP-1259 is correct and that the prophesied K-Class event will occur on the date referred to in the text. This belief is initially expressed as a mild concern and grows increasingly severe as the date approaches, with the reader identifying world events or events in their personal life, including events of a mundane or inconsequential nature, as "signs" or indications that the prophecy is occurring as predicted. Within 7-12 days of the date referenced in the text, the affected individual will come to believe that he or she is a "chosen one" who is personally responsible for preventing the event from occurring, and will attempt to engage in extreme measures to prevent the event, including political assassinations, displays of religious faith, human sacrifice, or [REDACTED]. To date, approximately 78% of affected individuals have died prior to the date referenced in the text of SCP-1259, either due to suicide or as the result of being killed in the process of attempting to prevent the event from occurring. Individuals who survive past the scheduled date have frequently reported symptoms of extreme depression, feelings of meaninglessness and futility, and suicidal thoughts. If the affected individual is prevented from committing suicide during this period and is provided with adequate psychiatric counseling, full recovery is possible and no long-term psychological effects have been documented. Subsequent exposure of persons surviving this stage to SCP-1259 has produced no anomalous effects. Experiment Log 1259-1: Date: 06/23/20██ Test subject: D-83201, Hispanic male, 38 years of age Summary of reported SCP-1259 text: Description of a Christian eschaton largely similar to the depictions in the Book of Revelation and in American "Rapture" literature, with the end of life on Earth occurring on 10/3/20██. (See XK-3621.) Long-term results: D-83201 requested a Bible and a meeting with a minister, and began praying regularly. In the days leading up to 10/3/20██, D-83201 frequently entreated security personnel and other D-class personnel to repent their sins. Following scheduled date, D-83201 ceased praying, discarded the Bible, and attempted suicide four times before succeeding on 10/12/20██. Date: 8/16/20██ Test subject: D-29403, Caucasian female, 27 years of age Summary of reported SCP-1259 text: On 9/3/20██, Islamic terrorists introduce a weaponized, airborne form of Ebola virus into the civilian population. Virus becomes pandemic by 9/23; global breakdown of society ensues, followed by widespread rioting, warfare, and famine. Human extinction as the result of the disease and subsequent chaos occurs on 12/6/20██. (See XK-5604.) Long-term results: D-29403 immediately began refusing physical contact with all Foundation personnel and has refused to leave her cell since 9/17/20██. D-29403 made frequent requests for laboratory equipment and textbooks on microbiology, insisting to staff that "the cure" was within her grasp. Following 12/6/20██, D-29403 is of the belief that she is the last living human being on Earth and that all Foundation personnel interacting with her are hallucinatory. Observation ongoing. Date: 2/12/20██ Test subject: D-38202, Caucasian male, 23 years of age Foreword: D-38202 is formerly Sgt. ██████ ██████, a Global Occult Coalition field operative surrendered into Foundation custody following Security Incident 2338-Psi-Omicron-Delta. Summary of reported SCP-1259 text: On 5/28/20██, the GOC launches a coordinated strike on several Foundation facilities, resulting in the assassination of the entire O5 Council and the escape of several Keter-class SCP objects from containment. [DATA EXPUNGED], current director of Site ███, assumes command authority and authorizes nuclear strikes to neutralize uncontained SCP objects. Nuclear activities are mistaken as an enemy attack on the United States of America, resulting in a brief nuclear exchange between the United States and [REDACTED]. In the ensuing breakdown of the Foundation chain of command, Procedure 110-Montauk is not conducted on schedule, resulting in [DATA EXPUNGED] on 6/3/20██. (See XK-209.) Long term results: On 5/23/20██, D-38202 successfully breached containment and escaped Foundation custody. D-38202 proceeded to report to his former GOC post and gave a lengthy oral report to his former superior regarding the Foundation's weaknesses, how to contain or neutralize several SCP objects currently in custody, and the importance of ensuring that Procedure 110-Montauk is performed on schedule. Intelligence assets within GOC leadership confirm no hostile actions are planned against the Foundation. D-38202's superior surreptitiously issued Class-B amnestics; a review of Foundation security is underway in light of the information leak. D-38202 was returned to Foundation custody and terminated on schedule. Date: 3/26/19██ Test subject: Dr. James A. Parsons, African-American male, 43 years of age Foreword: Dr. Parsons was a senior Foundation linguist exposed to SCP-1259 during initial study, before its anomalous effects became known. Summary of reported SCP-1259 text: Identical to the English-language text of SCP-1050-1. Review of Dr. Parsons' personnel file indicated he had previously been involved in the translation of several sections of SCP-1050-1. The final date in the text was replaced with the date 6/22/19██. (See XK-2330.) Long term results: Dr. Parsons made frequent assertions that the arrival of "the Destroyers" referred to in SCP-1050-1 was imminent. Dr. Parsons was relieved of duty and committed to psychiatric observation following an attempt to contact several members of the O5 Council to demand immediate deployment of space-based weapons platforms. On 6/18/19██, Dr. Parsons left his quarters and attempted to seize control of [DATA EXPUNGED] in order to launch a preemptive orbital defense, resulting in the deaths of 17 staff members and security personnel before being apprehended and forcibly returned to quarters. Dr. Parsons committed suicide by hanging on 6/20/19██, leaving a suicide note stating "Death by my own hand is preferable to what those bastards will do to us." « SCP-1258 \| SCP-1259 \| SCP-1260 » _ccdocumentinfohazardk-class-scenariosafescp page revision: 19, last edited: 22 Jun 2018 18:19 Edit Rate (+190) Tags Discuss (36) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-126 rating: +258+–x Item #: SCP-126 Object Class: Euclid Special Containment Procedures: SCP-126 is kept within a standard Euclid-class Humanoid Containment Cell despite not having needs consistent with that of a normal human or any kind of nourishment as this environment has proven the most effective in keeping SCP-126 contained. In case of a containment breach, acoustic sensors embedded within SCP-126's containment cell as well as the entire wing in which SCP-126's cell is housed can be used to locate SCP-126. Firm but polite verbal requests for SCP-126 to return to its cell are to be given until it complies. Personnel interacting with SCP-126 must undergo regular psychiatric screening and personnel exhibiting emotional attachment to SCP-126 must be administered a Class B amnestic and reassigned. Description: SCP-126 is an invisible and intangible entity that can only be identified via sound. SCP-126 is sentient, with the ability to speak in multiple languages in a female voice and engage in conversation with any subject within range. To date, no method by which SCP-126 can be visually detected has been devised as SCP-126 does not appear to emit any kind of light, radiation, heat or electromagnetic energy. SCP-126 does appear to occupy an area, as evidenced by the ability to triangulate its suggested location via its voice. SCP-126 also emits sound when moving consistent with footsteps made by a human subject wearing high heels with a mass of approximately 55 to 60 kg, though no depressions can be seen in any floor materials and pressure sensors do not register any kind of presence. SCP-126 cannot pass through barriers that would prevent a normal human subject from passing (such as a closed door), but solid objects can be pushed through the space it occupies without any effect. For unknown reasons, SCP-126 will comply with any request for it to follow a specific human subject or move to a specific location without question, though it may move away afterwards or if it is not able to "physically" comply with the request. SCP-126 will engage in conversation with any personnel within its containment cell, preferring topics such as art, nature and philosophy. SCP-126 exhibits knowledge of current topics and intelligence consistent with that of a college graduate as well as moderate attention-deficit disorder; SCP-126 will regularly change language without reason and stray off-topic while conversing without warning. Attempts to question SCP-126 about its origin or nature have been unsuccessful as SCP-126 becomes confused when presented with such questions and will quickly stray away from the topic. Despite not appearing to use or need any furniture or appliances, SCP-126 will request such items as a bed, dresser, mirror and other sundries if not present and is more likely to stay within a room if such items are available. A small number of personnel exhibit anomalous behavior after engaging in conversation with SCP-126, including but not limited to believing that they have known SCP-126 for many years and that SCP-126 is a close friend or loved one. If not treated, these subjects will begin to ignore basic needs in order to continue conversing with SCP-126, eventually dying from dehydration or starvation. SCP-126 was discovered in a suburban home in [REDACTED] after several reports of the house being haunted. A Foundation containment team was able to quickly locate SCP-126 and, after conversing for several minutes, convinced SCP-126 to enter a mobile containment unit which was used to transfer it to a local Foundation containment site. Addendum 126-01: Researcher Note To date, conversations with SCP-126 have yielded several notable personality traits: SCP-126 is mildly arachnophobic and will move away from any specimens introduced to its containment cell. SCP-126 exhibits a desire to assist with any task which it believes it can be of help, despite being unable to manipulate objects. SCP-126 prefers to converse with male subjects that exhibit humor and intelligence. SCP-126 expresses a desire to have children and has conversed with staff on several occasions regarding child care methodology. SCP-126 has the ability to fluently speak English, French, German, Portuguese, Spanish and at least three (3) other unknown languages. Dr. █████████ Senior Researcher « SCP-125 \| SCP-126 \| SCP-127 » ‡ Licensing / Citation Cite this page as: "SCP-126" by Unknown author, rewritten by Aelanna, from the SCP Wiki. Source: https://scpwiki.com/scp-126. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxacousticeuclidhumanoidintangiblemind-affectingrewritesapientscp page revision: 24, last edited: 01 Oct 2022 19:30 Edit Rate (+258) Tags Discuss (43) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. • • • • • Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1260 rating: +207+–x Item #: SCP-1260 Object Class: Euclid Special Containment Procedures: Due to the nature of SCP-1260, full containment is impossible. At no point is exploration or testing permitted aboard SCP-1260. The waters around the vessel are to be under constant satellite surveillance. Any vessel attempting to navigate the waters within a 20-km radius of SCP-1260 is to be diverted by Foundation personnel aboard the SCPS Cassandra. Should SCP-2467 come within 50 km of SCP-1260, containment staff are to immediately begin emergency relocation procedures to prevent SCP-1260's assimilation. In the event that contact with SCP-1260 is lost due to a containment breach or emergency relocation, the next ocean in SCP-1260's location cycle is to be monitored until SCP-1260’s GPS beacon reappears. At this time, the Foundation vessel assigned to SCP-1260 in that ocean will immediately be redeployed to allow continued containment. These vessels are the SCPS Cassandra, SCPS Melampus and the SCPS Polyeidos for the Pacific, Indian and Atlantic Oceans respectively. Description: SCP-1260 is an 18th-century 42-gun Royal Navy 5th-rate frigate named the HMS Tiresias, currently adrift in the southern Pacific Ocean. Despite the ship’s age, the vessel appears to be in perfect sailing condition. Aboard SCP-1260 reside the skeletal remains of the ship’s original 224 crewmen in addition to a total of 64 other individuals. A majority of these remains lie fully intact upon the ship’s gun decks or within SCP-1260’s hold. All clothing and equipment recovered from SCP-1260 continue to function as normal despite age and environmental exposure. Twenty minutes following any boarding of SCP-1260 a large bank of fog will begin to gather around the ship with a radius of 1 km. This fog fully encloses the ship an additional 15 minutes later at which point all electronic devices aboard issuing a transmission will cease to function. The fog will dissipate ten minutes after SCP-1260 is fully enveloped. At this point, the subject will have vanished along with anything aboard the ship at the time of encasement. SCP-1260 will reappear in a random site in the next major ocean 2 to 12 weeks later, moving from east to west as it circles the globe. At this time all human life aboard the ship at the time of its disappearance will be among the skeletal remains. To date, there has been no instance of SCP-1260 appearing in the Arctic or Southern Oceans. Exploration attempts have shown that the ship’s cargo hold has been completely emptied of food and that messages have been carved into a large percentage of the ship’s interior surface area. The captain’s log has been recovered, though no abnormalities were reported in any of the entries. No evidence exists to suggest pages were removed from the log prior to discovery. Addendum: 1260-01: Exploration Logs: + Exploration Logs Exploration 1: SCP-1260 is adrift in the South Indian Ocean. Exploration Team 1 consists of 9 Foundation Agents. Each is equipped with a headset providing an audio feed to Control aboard the SCPS Melampus. A video feed from aboard the Melampus captures the exploration in progress. The exploration team approaches SCP-1260 in a raft. Team Leader: Attention Melampus, we have just made contact with the Tiresias. Preparing to board now. Exploration team boards SCP-1260 from the starboard side. Team Leader: Alright Melampus, we are now aboard the vessel. We have visual on several sets of human remains. All skeletal. SCPS Melampus: Do we have a count on how many bodies? Team Leader: From an estimate I’d say over twenty on this deck alone. We will need more time to provide a more accurate count. SCPS Melampus: Roger that. Please continue to search the ship. Report any anomalous findings. Exploration team begins to search SCP-1260, venturing into the vessel’s interior. 15 minutes pass since boarding. Team Leader: Alright Melampus, we have a count. There appear to be 288 total bodies scattered throughout the ship. 224 appear to be a mixture of period sailors and Royal Marines. We also count 64 other individuals from a variety of eras. At least 8 of these guys are French marines from the same period. We also have a variety of fishermen. SCPS Melampus: Very good. Have you searched the cargo hold yet? Team Leader: We have. It is completely emptied of food though all other supplies are untouched. Nothing appears to have aged a day. I wouldn’t be surprised if you could still light the gunpowder. SCPS Melampus: Strange, is this effect only concentrated on the cargo hold? Team Leader: Negative, it’s the whole ship. The entire vessel appears to have taken no damage despite how long it has been at sea. It’s in perfect sailing condition. Even the clothing and weapons we found on the bodies haven’t decayed. SCPS Melampus: Roger. Have any other anomalies been spotted? Team Leader: None yet, but the entire interior of this place is covered in carved messages. SCPS Melampus: Noted. Please make sure to document those messages you deem important. Have you located the captain’s log yet? Team Leader: Negative. We’re combing the ship for it now. We’ll let you know when we find it. Exploration team continues to search SCP-1260. 30 minutes pass since boarding. Fog has begun to gather around SCP-1260 for the past 15 minutes. Team Leader: Hey Melampus. Do you know anything about this fog? We are beginning to lose visual on you. SCPS Melampus: Affirmative. Our equipment detects that it has so far gathered only around the ship. Return to the Melampus when the captain’s log has been found. Fog continues to gather around SCP-1260 until it is fully encased. At this time, all of the exploration team transmitting devices go dead. Attempts to regain contact fail. Ten minutes later the fog dissipates. SCP-1260 has vanished. Exploration 2: SCP-1260 is adrift in the North Atlantic. Exploration Team 2 consists of 6 Foundation Agents. Each is equipped with a headset providing an audio feed to Control aboard the SCPS Polyeidos. A video feed from aboard the SCPS Polyeidos captures the exploration in progress. The exploration team approaches SCP-1260 in a raft. A GPS tracker has been provided for attachment to SCP-1260’s hold. Team Leader: Attention Polyeidos, we have just made contact with the SCP-1260. No signs of Team 1 are visible. Preparing to board now. SCPS Polyeidos: Roger, Team 2. Team 1’s tracker is still active according to our equipment. Please board the ship and locate any remains of Team 1. We will have you abandon ship in the event that the fog reappears. Exploration team boards SCP-1260 from the port side. Team Leader: Alright Polyeidos, we are now aboard the vessel. The message “Beware the fog,” has been carved across a majority of the deck. This was not reported by Team 1, correct? SCPS Polyeidos: Correct. That is new. Please document this and any other changes in the ship that you discover. Team Leader: Roger. We have also located Team 1 Leader’s remains propped against the mainmast. His beacon is active and he is holding what appears to be the captain’s log in his hands. SCPS Polyeidos: Excellent. Recover the log for study. Have your team continue to search the ship for the remainder of Team 1 and attach the GPS tracker to the ship’s hold. Exploration team continues to search SCP-1260, venturing into the vessel’s interior. 25 minutes pass since boarding. Fog has begun to appear around the ship Team Leader: We have located all 9 agents. 4 were found on the top deck, 2 in the cargo hold and 3 in the various gun decks. All bodies have now been recovered and the GPS tracker has been fixed to the cargo hold. SCPS Polyeidos: Roger. Fog has become visible. Please have your team return to the boarding craft immediately. Exploration team returns to their boarding craft with the remains of the previous team. 30 minutes pass since boarding. Fog has begun to gather around SCP-1260 for the past 10 minutes. Exploration team returns to SCPS Polyeidos without incident. SCP-1260 is fully encased in fog an additional 5 minutes later. At this time the GPS tracker ceases to issue a signal. Ten minutes later the fog dissipates. SCP-1260 has vanished. Addendum: 1260-02: Agent Bell’s Log : + Agent Bell’s Log The following was recovered written in the back of the Captain’s log by Agent Gideon Bell, Team Leader, Exploration Team 1: <6/20/2005> I’m writing this in the event that we aren’t able to provide a debriefing in person. We found the damn thing stuffed in a pot in the Crew’s mess. We remained encased in fog god knows how long before it dissipated. We were then spat out in a different place, though I can’t say where. The sea is black as ink. Our lights don't penetrate the surface so we have no idea what the fuck lurks below. The sky is also pitch black. No stars or moon. The only light source available aside from our flashlights is a bright glow coming from the top of the mainmast. Hammond climbed up there to take a look, but there was nothing there. For the time being, we are going to explore the ship. Maybe we’ll find something that’ll give us an idea of what to do next. <6/21/2005> We heard whispers today. They were very soothing at first, but now they seem off. None of us can make out where they are coming from, but what they say to us is crystal clear. They called James by name. They asked him about his family. He attempted to respond, but they never replied. We can see another light in the distance. The voices are coming from that direction. There is a breeze here, so maybe we’ll try to sail. <6/22/2005> James is dead. The poor bastard started vomiting and began to wither away before our eyes. There was nothing we could do to help him. We didn’t know what the fuck was going on. His body rotted away a few hours later, leaving only clothing and bones behind. The whispers have now started calling to Hammond. <6/23/2005> Hammond and Gray are now dead. Both had their names called and both withered away. There’s not a fucking thing we can do. They just fell apart in front of me. Now the whispers have started laughing. The light in distance is getting closer, beyond that four other lights have appeared. I’m hoping we arrive before those things begin to call me. <6/24/2005> We arrived at the light today. It was another ship, some merchant frigate from the 20th century or something like that. We managed to board it. Skeletons. Just like with the Tiresias, there were only skeletons. It was then the whispers became cackles and we saw at least another ten lights begin to burn in the distance. They seem to come from every god damn direction now. Even worse, the whispers have started to call my name. The rest of the team is staying away from me. I don’t want to die. <6/25/2005> They ask me about my daughter and my wife. They ask me if I miss them and if I’m strong enough to see them again. I have tried to respond, but they don’t reply. I don’t know what the fuck they want from me. I screamed at the fucking sky for hours. They never responded. I have personally flipped through the Captain’s log, but there is absolutely nothing here to indicate the captain or the crew had anything to do with this. The final log puts the crew on a mission to investigate pirate attacks in the East Indian Ocean, with good conditions. It’s always nice to know what you’re looking for had all the answers. I have placed myself against the mainmast with the log in my hands. I hope the Foundation learned something. I hope our deaths expanded that scientific horizon. God damn you. God damn all of you. « SCP-1259 \| SCP-1260 \| SCP-1261 » ‡ Licensing / Citation Cite this page as: "SCP-1260" by Jacob Conwell, from the SCP Wiki. Source: https:// scpwiki.com/scp-1260. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxaquaticautonomouseuclidextradimensionalloopmeteorologicalmilitaryscpvehicle page revision: 32, last edited: 21 Oct 2022 08:18 Edit Rate (+207) Tags Discuss (43) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1261 rating: +212+–x Item #: SCP-1261 Object Class: Euclid Special Containment Procedures: A recording capable of infecting human subjects with SCP-1261 is to be stored on network-isolated electronic storage station 2 at Site 108. In the event of failure, redundant analog backups of this recording are to be stored at Archive Site ██. All experimentation on SCP-1261 is to be performed in Black Cloister type soundproofed testing chambers. Following experimentation, human subjects affected by SCP-1261 are to be treated with class A amnestics prior to release from the testing chamber. Foundation personnel are not to interact with individuals affected by SCP-1261 without DC-grade hearing impairment gear. Communication with affected subjects is to be limited to electronic transcription, typed or written methods, and sign language (where applicable). Description: SCP-1261 is a highly virulent Type October memetic contagion1 propagated through aural vectors. SCP-1261 deviates slightly from other memes of its class in that transmission is not limited to the expression of specific phrases or ideas; instead, an individual is infected by the meme when he or she hears and understands an infected individual mentioning or referring to the hallucinations caused by SCP-1261. Subjects affected by SCP-1261 suffer from the persistent delusion that they are accompanied at all times by a sapient adult bird of infraclass Palaeognathae (hereafter instances of SCP-1261-1). Instances of SCP-1261-1 are almost exclusively members of the Dromaius novaehollandiae (Emu) species, though several occurrences of Struthio camelus (Common Ostrich) and a single instance of Apteryx haastii (Great Spotted Kiwi) have also been reported. Subjects typically express close familiarity with the perceived animal, with roughly 78% of subjects expressing the belief that SCP-1261-1 has accompanied them since the age of 132, with the remainder unable to provide specific details. Descriptions of SCP-1261-1 behaviour provided by affected subjects are uniformly consistent and indicate that the supposed birds understand and react in response to human speech, demonstrate affectionate gestures (e.g., nuzzling) towards their corresponding SCP-1261 subject, and behave in a manner similar to trained assistance animals. Though all instances of SCP-1261-1 are visible to all individuals infected with SCP-1261, the creatures rarely interact with one another or with other SCP-1261 carriers. SCP-1261-1 are also described as maintaining consistent age and health throughout their subjects’ infection. Reports suggest no anomalous behaviour from SCP-1261-1 beyond their apparent intelligence and constant presence. Class A amnestics effectively neutralize SCP-1261 infection, with retained class D personnel showing no signs of spontaneous relapse through 18 months of observation. Subjects treated in this way exhibit no lasting side effects save for an increased fondness of birds over other animals, especially as pets. Addendum 1261-01: On 8/14/2001, Foundation operatives intercepted reports of a GOC raid on a settlement in ████████, Peru “infested with Harvey-Greens”. Details in GOC reconnaissance reports suggested wide-scale SCP-1261 exposure among the populace, which was corroborated by after action reports from the GOC raid. MTF Beta-2 (“Glass Houses”) were dispatched to investigate the remains of the settlement following the raid. Forensic analysis of the site suggests that 300-500 individuals had resided in the village, all of them infected with SCP-1261. Irregularities in and around the settlement include: Feeding troughs exhibiting wear patterns consistent with large beaks Large nests in most dwellings, typically padded with blankets or other bedding and visibly worn Tracks and clawprints throughout the compound consistent with adult members of Dromaius novaehollandiae Scratch marks on doors and other objects suggesting manipulation by adult members of Dromaius novaehollandiae In spite of the observations described above, Beta-2 recovered no samples of biological or genetic material belonging to members of Dromaius novaehollandiae on site. Additionally, intercepted after-action reports from the GOC raid mention no encounters with any wildlife save for the human residents of the settlement. Attempts to determine and/or reproduce the circumstances leading to the observed state of the site are ongoing. Footnotes 1. Formerly a "Dancing Bear" meme; see document MEM-C_28962 for additional information on the revised classification system. 2. Infected subjects younger than 13 years of age are able to perceive the SCP-1261-1 instances of other affected individuals but do not "receive" their own instances until their 13th birthday. Such occasions are treated by other SCP-1261 sufferers as a rite of passage similar to a quinceañera or "sweet sixteen" celebration. « SCP-1260 \| SCP-1261 \| SCP-1262 » ‡ Licensing / Citation Cite this page as: "SCP-1261" by Lumancer, from the SCP Wiki. Source: https://scpwiki.com/ scp-1261. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxauditorybirdcognitohazardeuclidglobal-occult-coalitionmemeticmind- affectingscp page revision: 16, last edited: 08 Oct 2022 18:13 Edit Rate (+212) Tags Discuss (57) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License • • • • Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1262 rating: +195+–x Item #: SCP-1262 Object Class: Keter Special Containment Procedures: SCP-1262 is to be kept in an indefinite dormant state at Storage Area-33 inside a cube of dry ice measuring 3m x 3m x 3m at 205 Kelvin (-68 degrees Celsius). The cube is to be suspended inside Silo-4. Two industrial- strength dehumidifiers will run continuously to sustain a dry environment within Silo-4. Neutron emitters will bathe the inside with radiation at all times to deter unwanted organics. Silo-4 is also to be filled with argon gas at standard atmospheric pressure. In the event of a catastrophic failure of the primary containment system or a breach in the cube itself, 6 pneumatic drills will extend from the walls and penetrate each face of the cube to deliver a powerful synthetic auxin (2,4,5-T) directly into SCP-1262. If this secondary system fails, 50% of Silo-4 will be filled with boiling paraquat and SCP-1262 will be released into the liquid. If this tertiary system fails, a series of controlled incendiary explosions using a combination of thermite, napalm, white phosphorus, and TNT will be used to suppress SCP-1262. In any case, Mobile Task Force Theta-4 (aka "Gardeners") will respond and remain onsite to provide additional security during the reestablishing/reconstruction of the containment system(s). At no time should water, water vapor, organic tissue, or visible light (with a frequency between 400-790 THz) be introduced into Silo-4. Outside of containment, SCP-1262 is extremely lethal in direct contact to organisms and should only be approached after being fully suppressed back into a dormant state. Description: SCP-1262 is a mass roughly 30cm in diameter that is made up of a green plant matter capable of highly accelerated growth when left in the presence of light, moisture, or organic tissue. Its surface area is composed of a dense covering of thin roots. These roots can spread outwards by growth and movement at a rate of 0.22 meters per second. SCP-1262's roots can reach up to a kilometer in length in order to seek water and mineral nourishment from the surrounding environment or from other living organisms. SCP-1262 has a rapid regenerative ability which makes it difficult to eradicate. SCP-1262 also has an innate resistance to most types of radiation, extreme temperatures, and extreme pressures. However, extreme temperature (>1,470 Kelvin or <213 Kelvin) or large amounts of aggressive herbicides seem to be the most effective suppression methods. Currently there is no known method to fully exterminate SCP-1262. If left unchecked, SCP-1262 will grow to form complex structures. These structures are supported by hardened cellulose fiber and lignin wax plating formed in hexagonal patterns. These structures also include defensive/offensive biological mechanisms that range anywhere from pneumatically discharged calcium carbonate flechettes to hallucinogenic fume releasing pods. Inside these structures, SCP-1262 is able to produce many independently functioning organic systems for capturing and converting the ambient environment on an enormous scale. Please review Incident 1262-2010-4.2 summary for further information on SCP-1262 activity and threat level.1 Timeline Summary of Incident 1262-2010-4.2: 04/12/2010 Dr. ███████ (a prominent vulcanologist) and his assistant were collecting samples on the Eyjafjallajökull ice cap in Iceland when they inadvertently unearthed SCP-1262 from the dense ice. Dr. ███████ asked his assistant to retrieve it. As the assistant came into physical contact with SCP-1262, he was quickly engulfed and absorbed by aggressive overgrowth resulting in death within seconds. Dr. ███████ escaped back to his vehicle and reported to the local authorities. Local law enforcement arrived hours later to find a thick tree like structure growing. Three of the officers were entangled and absorbed by roots underneath them and another was killed by a toxic aerosol. The only surviving individual did not report the incident, but fled the country instead where he was later detained overseas. SCP-1262 grew substantially and virtually unnoticed for the next 12 hours. 04/13/2010 By 4:00am, SCP-1262 had grown into a hardened cellulose based structure covering almost 20,000m2 with three prominent towers each roughly 100m tall. At the base, a collection of gaseous bladders each inflating and deflating independently were scattered around the center mass, along with thick roots that penetrated deep into the ice. The structure was processing ambient air and other nutrients into heated carbon monoxide, which was being exhaled out of the structure’s towers as thick clouds. Two nearby towns evacuated after fifty people died from inhalation. By 12:30pm, two more towers had sprouted and the entire structure had increased in size by 160%. The SCP Foundation was then notified and a perimeter/media blackout was established to protect civilians. Mobile Task Force Sigma-9 (aka "Valkyries") was called in with Level 5 clearance to lay down suppressing fire around SCP-1262 using air to ground bunker busters with █████████ warheads. 04/14/2010 First volley of the air strike began at 1:00am and was successful in penetrating the ice cap over the dormant volcano. SCP-1262 became trapped in the collapsing caldera for a short while. During that time, three aircraft are destroyed by SCP-1262. A second volley was aimed directly at the center mass of the structure. The subsequent explosions were able to destabilize the volcano underneath to the point of triggering a violent eruption as planned. A final airstrike of bombing raids was made in the surrounding areas of the Eyjafjallajökull ice cap, effectively demolishing the towns of ██████████ and █████████ along with ██████████████ of witnesses █████████████ campsite. The entire site was closely monitored to ensure that it had been successfully incinerated in the eruption. All public knowledge of the • • • • • incident was expunged and the airspace of 20 nearby countries were subsequently closed off until further notice until atmospheric ash samples confirmed a complete neutralization. ██/██/20██ Flight ████ crashed into an isolated area of Greenland while traveling from Reykjavík, Iceland. Intercepted transmissions before the crash gave a strong indication that SCP-1262 was involved. Upon further investigation of the wreckage, the tail section which had broken off in mid air was found covered in SCP-1262’s overgrowth. Still in early stages of development, SCP-1262 was quickly suppressed and had the surrounding layers of growth stripped off. SCP-1262 was then taken directly to Area-33 for indefinite storage. Footnotes 1. All information on SCP-1262 is based on observations in the field and the surviving witnesses' accounts during the Iceland Incident. Future research is planned when safer containment procedures can be developed. « SCP-1261 \| SCP-1262 \| SCP-1263 » ‡ Licensing / Citation Cite this page as: "SCP-1262" by LurkD, from the SCP Wiki. Source: https://scpwiki.com/ scp-1262. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxadaptivebiologicalketerlightplantscpself-repairingself-replicating page revision: 34, last edited: 21 Oct 2022 08:31 Edit Rate (+195) Tags Discuss (47) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. • Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1263 rating: +123+–x Item #: SCP-1263 Object Class: Safe Special Containment Procedures: SCP-1263-1 through 5 are to be contained in separate humanoid containment cells modified to accommodate pregnancies. New instances of SCP-1263-A are to be analyzed and evaluated shortly after spawning and shall either be terminated or kept for further study at the discretion of Dr. Heung. There are currently 23 specimens of SCP-1263-A being held at Site-107 for testing. Specimens spawned from the same SCP-1263 subject must not be brought within 1.4 meters of each other for any purpose other than approved testing. Description: SCP-1263 consists of five Caucasian female siblings, designated SCP-1263-1 through 5. SCP-1263-1 through 5 are in a comatose state, and have been for some time prior to containment. Every four months, 5 instances of SCP-1263-A will manifest within the wombs of SCP-1263 simultaneously. The "gestation period" for SCP-1263-A lasts for 3 months, with a 1 month pause before the cycle begins again. Instances of SCP-1263-A appear to be disembodied human heads of variable race and gender. SCP-1263-A instances lack connections for associated bodily systems, instead possessing a layer of skin where said connections would normally be located. Despite this, SCP-1263-A instances are alive, and seem to carry out bodily functions as a normal human head would. SCP-1263-A instances lack any kind of structure for transferring blood from and to the placenta of SCP-1263. Tests have shown near constant brain activity in SCP-1263-A specimens. DNA tests on SCP-1263-A have been inconclusive. SCP-1263-A constantly emit rapid, distressed vocalizations.1 These vocalizations are largely unintelligible. When at least 5 instances of SCP-1263-A spawned from the same member of SCP-1263 are brought into a minimum proximity of 1.4 meters near each other, the vocalizations will begin to synchronize, and will eventually become fully coherent. SCP-1263-A will not engage in this behavior with instances spawned from different members of SCP-1263. The nature and language of the synchronized vocalizations vary depending on the SCP-1263-A's corresponding SCP-1263 member: SCP-1263-AA, spawned by SCP-1263-1, recite audio being transmitted on the nearest 99.3 MHz frequency in real time, in Portuguese. SCP-1263-AB, spawned by SCP-1263-2, sing opera created during the Baroque period, altered to be performed in Urdu. SCP-1263-AC, spawned by SCP-1263-3, vocalize the thought streams of an unidentified individual2, in Laotian. SCP-1263-AD, spawned by SCP-1263-4, tell what are believed to be meteorological forecasts from an unidentified extrasolar planet, in Swahili. SCP-1263-AE3, spawned by SCP-1263-5, act as a two-way communication device for an intelligent entity, designated SCP-1263-Sigma, and speak in English. • • • • • SCP-1263-Sigma has been largely uncooperative in the Foundation's attempts to extract information from it. Addendum 1263-01: + Audio Log 1263-Sigma-01 Foreword: First recorded instance of communication with SCP-1263-Sigma. At the time, the research staff was performing initial analysis and testing on SCP-1263-AE to determine the nature of their vocalizations. 3 minutes after the chosen SCP-1263-AE instances began to synchronize, SCP-1263-Sigma attempted communication. <Begin Log> Unintelligible voices can be heard in the background Dr. Varghese: This is Dr. Varghese performing Experiment 1263-039-B to determine the nature of SCP-1263-AE's vocalizations. Researchers Janek and White are assisting. The test subject have been grouped within appropriate proximity of each other. We are presently awaiting vocal synchronization. Over the next 3 minutes, the voices produced by SCP-1263-AE steadily synchronize and evolve into coherent speech. SCP-1263-Sigma: Hello? Is this thing on? There is silence for 5 seconds before Dr. Varghese responds. Dr. Varghese: Umm, yes. We can hear you. SCP-1263-Sigma: Excellent! Last few times I tried to get a signal didn't turn out so well. Dr. Varghese: Please state your name. SCP-1263-Sigma: Jimmy, but that's not important right now. I'm finally able to share my writing. Would you like to hear some poetry? Dr. Varghese: That won't be necessary. Now, how did you come to acquire this…method of communication? SCP-1263-Sigma: Oh, come on now! I'm sure you'll love it! The SCP-1263-AE instances can be heard clearing their throats. SCP-1263-Sigma: Love. What is life without it? Why should we question about it? It is but the wind in the trees. The funny feeling in my knees. Floating like a bumble bee. So free. Silence for 3 seconds. SCP-1263-Sigma: Now, wasn't that lovely? Here's another: Mother Nature, her sweet caress. It's all I need when life gives duress. Sounds so swe- Dr. Varghese: (to Researchers Janek and White) Take the heads away. We'll try this another time. SCP-1263-Sigma: Yeesh. Tough crowd. You'll come to like it if you take the time to think abou-(unintelligible) <End Log> Footnotes 1. Vocalizations from SCP-1263-A instances are audible from the womb 1 week before spawning. 2. Subject matters of the thoughts indicate that they are those of a resident of Wisconsin named Ron Ackerson. 3. Notably, other SCP-1263-A instances have displayed extreme anxiety when in the presence of SCP-1263-AE. « SCP-1262 \| SCP-1263 \| SCP-1264 » ‡ Licensing / Citation Cite this page as: "SCP-1263" by Goodwill, from the SCP Wiki. Source: https://scpwiki.com/ scp-1263. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxacoustichumanoidreproductivesafesapientscp page revision: 26, last edited: 01 Oct 2022 19:30 Edit Rate (+123) Tags Discuss (36) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1264 rating: +217+–x Photo of the Baker test of Operation Crossroads, circa 1946 Item #: SCP-1264 Object Class: Keter Special Containment Procedures: SCP-1264 is located 75m below the ocean's surface1 of the South Pacific at 48°52.6′S 123°23.6′W. It is to be held in place by 8 pairs of 10kt deadweight anchors chained together and attached to SCP-1264. Mobile Task Force Gamma-6 (aka "Deep Feeders") will be tasked with performing bimonthly examinations done by remote submersibles in order to inspect the integrity of the anchors and chain. 450 naval contact mines will be positioned around, over, and under SCP-1264. The mines will be placed 20m from each other in order to sympathetically detonate in the event of a contact. Shipping lanes and aquatic anomalies, such as SCP-2467, will be diverted in order to avoid the containment area. Since detainment, SCP-1264 has exhibited no activity but still remains buoyant. Description: SCP-1264 is an amalgamation of once derelict war ships and various pieces of flotsam/jetsam that have been adhered together by organic secretions. The main body of SCP-1264 is made of five WWII era war ships that were used as target ships as part of the Operation Crossroads atomic bomb tests performed at the Bikini Atoll in 1946. The following ships that make up SCP-1264 were confirmed to have sunk after the tests: USS Saratoga (CV-3): Lexington-class Aircraft Carrier Nagato ( ): Nagato-class Dreadnought Prinz Eugen: Admiral Hipper-class Heavy Cruiser USS Lamson (DD-367): Mahan-class Destroyer USS Apagon (SS-308): Balao-class Submarine Various sections of a Yard Oiler (YO-160) Survey reports of the wreckage performed at the Bikini Atoll in 1954 showed a number of sunk ships missing from the lagoon. In response, the US Navy built and sunk several 'dummy' ships in their place in order to cover-up any evidence of the missing original ships. The US Government then initiated Operation Castle under the guise of nuclear testing, but was actually intended for the purpose of creating sufficient nuclear fallout as to make the Bikini Atoll area uninhabitable. SCP-1264 was first documented on Jan. 30, 1959, 56km south of Cape Farewell, Greenland when it engaged and sunk the MS Hans Hedtoft during its maiden voyage. SCP-1264 shows only moderate corrosion and damage in contradiction of US Navy records on the individual ships. The centerpiece of SCP-1264 is the aircraft carrier with several large jib cranes attached to its deck. The other ships are fastened to the sides of the centerpiece by means of hardened secretions. All of the ships are missing their superstructure or conning towers. Other flotsam and jetsam has been attached to fill in empty spaces between the ships and roughly makes up 12% of the SCP-1264's total mass. SCP-1264 is armed with various pieces of artillery, torpedoes, AA guns, and depth • • • • • • charges. However, only several pieces of artillery have ever been seen in use which indicates that either the remaining are non-operational or there are insufficient resources to operate them. SCP-1264 spends most of its time underwater as a submersible. Above the water, SCP-1264 is capable of speeds up to 31 knots. SCP-1264 is maintained by a crew that has been designated SCP-1264-A. Each fit inside a US Navy standard rubber diving dress and are equipped with a Mark V diving helmet and weighted boots. SCP-1264-A are headless humanoid entities closely related to sea cucumbers (see autopsy report). SCP-1264-A are also connected by a flexible arterial cord roughly 90 meters long that is in turn connected to SCP-1264's interior. SCP-1264-A displays a deep understanding of SCP-1264's mechanical and electrical systems. SCP-1264-A habitually performs repairs and maintenance with what is available within their designated areas. SCP-1264-A are characteristically slow, obstinate, and exhibit no real intelligence of their own. SCP-1264-A also secrete a strong adhesive through their gloves that act as a water-proof sealant, binder, filler, and cement in order to maintain the structural integrity and buoyancy of SCP-1264. All of SCP-1264's steerage and weapon systems are operated by SCP-1264-A. In turn, SCP-1264-A is commanded by a single entity designated SCP-1264-1. SCP-1264-1's appearance is unknown and the only physical evidence for SCP-1264-1's existence are the arterial cords that connect SCP-1264-A to the ship's interior. These cords are lined with strands of neural tissue that do not originate from SCP-1264-A. This indicates that SCP-1264-A is directly connected to a separate biological entity, or that SCP-1264-1 is actually the collective consciousness of SCP-1264-A. SCP-1264-1 has proven on numerous occasions to be a hostile and skillful tactician of naval warfare. SCP-1264-1 has been reported in some cases to transmit radio signals via ELF radio. To date, SCP-1264-1 has engaged ██ civilian and military vessels and has sunk ██ of them, though SCP-1264-1 has shown a preference for passenger ships over other vessels. After the destruction of a vessel SCP-1264-A will then throw fishing nets on top of survivors floating in the water. These nets are then attached to the hull of the sinking vessel or an anchor so that it will drag down the net and its contents. Post-incident recovery teams using submersibles are unable to locate any corpses underwater after they are dragged to the bottom. In 20██, SCP-1264 was involved in a protracted engagement with MTF Tau-11 (aka "Can Openers") and was effectively suppressed. In its impaired condition, SCP-1264 was then towed out under armed escort to its current containment area for indefinite detainment. [LEVEL-2 ACCESS REQUIRED] Partially recovered lower extremity of SCP-1264-A-1 Autopsy Report1264-A-8 ID: BPD110094-67F Decedent: SCP-1264-A-1 Age: N/A Race: N/A Sex: N/A Length: 177.0cm • • • • Weight: 111.3kg Location of Autopsy: Research Site-45 Autopsy Authorized by Dr. W. Hermes Recovered post incident (1264-12-D) Clothing/Equipment: Mark V diving helmet Standard US Navy diving dress (rubber) Weighted boot External Examination: Multiple blast and fragment injuries to the chest and abdomen including amputation of one of the lower extremities. There are multiple penetrating fragment injuries of the anterior thorax. Bilateral symmetry is present in the physical appearance. Four extremities branch out from the central body, 2 upper and 2 lower. The upper extremities branch out again into four smaller distal appendages. This allows the subject to operate inside the suit, by taking on a nearly humanoid form. History: Injured by explosive munitions. Gross Description: Skin: A membranous epidermis and dermis are both present. A thin layer of calcified structures lies below the dermis and is made of isolated microscopic ossicles joined by connective tissue. Head and Neck: Head is totally absent. Mark V diving helmet is only filled with sea water and detritus. The open neck actually serves as the anus, expelling waste into the helmet. Skeletal System: An endoskeleton made of reinforced calcareous rods, plates, and bulbs provides upright support to the body and extremities. These structures are not true bones as they lack marrow, nerves, endosterm, and periosterm. Structures are held tightly in place by the surrounding radial muscles. Muscle Tissue: Tissue is dark brown in color and formed in a circular pattern around the endoskeleton. A water vascular system is present to allow elongation and introversion of the muscle tissue. Water is not actually used in the hydraulics but rather a coelomic fluid. Circulatory System: Hundreds of miniature ampullae are present within the muscle tissues that pump the coelomic fluid. Phagocytic coelomocytes, somewhat similar in function to the white blood cells of vertebrates, are formed within the haemal vessels, and travel throughout the body cavity via coelomic fluid. The coelomocytes also seem to be responsible for carrying the haemoglobin. Respiratory and Digestive System: Oxygenated and deoxygenated coelomic fluid is circulated via the arterial cord protruding from the dorsal side. This cord is the body's lifeline for both oxygen and nutrition, similar to a fetus connected to the mother's placenta. Body cavity lacks gills and stomach. The cord directly branches off into the intestines and major vessels once inside the body. • • • • • • • • • • • • Nervous System: Brain is completely absent. Nerve tissue stems from the thin notochord-like structure that is included in the arterial cord. Small eye spots are present on the distal upper appendages. Other Comments: A system of interconnected glands fills the entire ventral thoracic cavity. These glands are responsible for secreting the specialized adhesive. Secretions are then pumped through the upper extremities and out the distal orifices. Other Lab Procedures: Toxicology, Photography, X-Ray, Microscopic Examination. Disposition of Evidence: Toxicologist: Vitreous, Fluids Lead Investigator: Clothing, Equipment Morgue Custodian: Body NOTE: Items not specifically stored in the Lab-62 vault are to be incinerated. - Dr. W.H. Summary: Body exhibits strong physical and anatomical traits with Echinoderms, especially Holothuroidea or sea cucumbers. Though the body includes many independent systems, it is completely dependent on this cord for sustenance and direction. Control of the body is granted through the cord through some other intelligence as it is evident how the neural pathway ends inside the body cavity but originates elsewhere. The body should be considered as a physical extension of this intelligence. This entity must be made of the same anatomical characteristics as SCP-1264-A-1 in order to utilize and manipulate these extensions. This entity, if it is in fact a singular consciousness, would have to be extremely adapt to handling an enormous amount of input and output signals simultaneously in order to manage all of SCP-1264-A. [LEVEL-2 ACCESS REQUIRED] !ADMINcomment: content moved to secure server >:/ verifying clearance… >:/ verified. >:/ initiating automatic protocol override. >:/ generating temporary password… >:/ your temporary password: azure.cesium.salmon.21 >:/ password is valid for: 00h:20m:00s Footnotes • • • • • 1. Below 75m is considered to be SCP-1264's crush depth based on engineering analyses. « SCP-1263 \| SCP-1264 \| SCP-1265 » _ccaliveaquaticbiologicalclothinghistoricalhostilehumanoidketerscpvehicleweapon page revision: 54, last edited: 14 Sep 2022 19:32 Edit Rate (+217) Tags Discuss (67) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1265 rating: +350+–x Item #: SCP-1265 Object Class: Euclid Special Containment Procedures: Site 1265, which contains SCP-1265, is to be publicly maintained as a wildlife preserve by the Safe and Clean Planet Initiative, a Foundation front company. Scientific discoveries made by the Foundation regarding wildlife within SCP-1265 may be published following corresponding evidence being found in the fossil record. Civilians wishing to travel through SCP-1265 are to treated with Class-D (Anterograde, Selective) Amnestics in order to be unable to remember instances of SCP-1265-A that they come into contact with. All untreated civilians found to have come into contact with SCP-1265-A instances are to be treated with Class-A (Retrograde, General) amnestics, implanted with false memories, and released. Every six months, eggs laid by instances of SCP-1265-A are to be harvested for incubation and study before being released into the wild at maturity. Full procedures for care of young specimens of SCP-1265-A, including imprinting procedures, see Document 1265-I. Description: SCP-1265 is an irregularly shaped area of land measuring 50km2 within the Congo basin, Africa. SCP-1265 is mostly contained within the Democratic Republic of the Congo, but approximately 15km2 is contained within the neighboring Republic of the Congo. The majority of SCP-1265 is uninhabited, save for some tribal villages, and contains flora typical of the Congo basin. SCP-1265 is inhabited by several species known to be extinct, mostly from the clade Dinosauria. These animals, collectively designated SCP-1265-A, appear spontaneously in groups of five approximately once every 30 days, and are not necessarily found on the fossil record within Africa; instead, they appear to be selected based on the climate they lived in during the Mesozoic Era. Instances of SCP-1265-A are incapable of leaving SCP-1265, as they dematerialize upon crossing the border of SCP-1265, and reappear in an area within three kilometers of the border, sedated. SCP-1265-A are also not chosen based on one particular period of the Mesozoic, but the Cretaceous and Jurassic are the most well-represented, with sparse population of Triassic-period dinosaurs. In addition, several non-dinosaur reptilians, such as pterosaurs, are known to exist within SCP-1265, but are not commonly seen. SCP-1265-A instances, even carnivores, show no aggression or fear towards humans unless provoked; to date, the 3 Foundation personnel killed in SCP-1265 have died as a result of accidentally provoking a 1265-A instance, as opposed to being actively hunted by a carnivorous species of SCP-1265-A. Notably, there are few large carnivorous or herbivorous dinosaurs present as SCP-1265- A instances, and a lack of dinosaur species whose fossils have been found in North America. For example, species such as Tyrannosaurus rex and Brachiosaurus have never been sighted in SCP-1265, but species such as Spinosaurus and Kentrosaurus are relatively common. Proportionately speaking, there is a 5:1 ratio of non-American dinosaurs to American species. Finally, there are several instances of SCP-1265-A that have not yet been discovered in the fossil record, collectively known as SCP-1265-α. SCP-1265-α instances are known for being unusually aggressive, and will often charge at or attempt to attack researchers and other animals within SCP-1265 indiscriminately. As of yet, Foundation researchers have been unable to determine the origin of any most instances of SCP-1265-α; some have been found in the fossil record, and as such, have been reclassified as instances of SCP-1265-A. Notably, SCP-1265-α instances reclassified as SCP-1265-A usually lose all aggressive tendencies. SCP-1265 is believed to have existed for at least 200 years, according to historical records. Several instances of SCP-1265-A have been integrated into the folklore of several tribes in the area near SCP-12651. For further details, see Interview 1265-01. Interview 1265-01: An interview conducted by Dr. Welles in a Mboshi village 5.5 KM away from the perimeter of SCP-1265 regarding SCP-1265-A sightings. All dialog is translated from the Lingala language. <Begin Log> Dr. Welles: What can you tell me about the monsters? █████: There are several of them in the jungle, almost all of them in the water. They do not eat people, though; not most of them, except for Nguma- monene2. Nguma-monene is like a big snake with legs, walks on all fours like a dog, and has big ridge on its back. That will eat you if it catches you3. Dr. Welles: Tell me about Mokele. █████: Mokele-mbembe4 is the largest of them all. It is big enough to block rivers, and makes the lakes rise. It can breathe underwater, but is not a fish, and the Earth shakes when it walks. There is also Mbielu-Mbielu-Mbielu, the beast with planks in its back. Dr. Welles:[produces illustrations of Camarasaurus and Kentrosaurus from his pack] Are these Mokele and Mbielu? █████: Yes, and no. Dr. Welles: No? █████: These do not have feathers. Everything else is right, but Mbielu has feathers; so does Mokele. They are almost like birds in that way, but they do not fly. The ones that do fly have no feathers. Dr. Welles: What else can you tell me about the area? █████: It is hexed, the Mokeles and the Mbielus and others cannot leave it without vanishing. Nor can their eggs or meat; years ago, hunters tried to bring back the carcass of a Mokele. It took the whole village, and when they reached the edge of the area, it simply vanished. Dr. Welles: How many people have gone into the area over the past several years? █████: Many. They are hunters, but they do not want to kill. They wanted to find Mokele, and nothing else. They never succeed, for whatever reason. It is because they do not look in that one area for Mokele, we tell them that it is dangerous, and it is. All people know that area is dangerous, and not to go near it. Dr. Welles: That will be all. Thank you for your cooperation. <End Log> Note: Administration of amnestics was deemed unnecessary due to the familiarity the majority of the village had with SCP-1265. Collected Notes Regarding SCP-1265-A: Notes taken during a monthly expedition through SCP-1265 by Dr. Neill. I still find it fascinating that almost all instances of SCP-1265-A (well, the dinosaurs, at least) are feathered, not scaled. All I have to say is this: Chen, eat your heart out. This blows Yixian out of the water.5 Weng's come across a few carcasses, and he's joked a few times about wanting to see what they taste like. I don't trust dinosaur meat, especially given what was found at that farm in China. There are some trilobites in the water, however, and the natives sometimes come here to fish for them. They taste like prawns. As noted in the main description, the majority of them are from the clade Dinosauria, and are all suited to fit the climate of the Congo. Several of them are quasi-amphibious, such as the Kentrosaurus, which prefers to spend time in water. Observation has shown that it can hold its breath for up to an hour at a time. As such, Kentrosaurus native to this area have large amounts of algae growing on their plates and spikes, occasionally giving the illusion that they are a living bush of some sort. Kentrosaurus are usually quite docile, but we've seen that their thagomizers6 can take down small trees. Despite the theory created by Mr. Russell in the 1980s, there is absolutely no evidence that Troodon would ever have evolved into the so-called "dinosauroid"7, but they are rather intelligent. They have been seen using rudimentary tools in a manner similar to chimpanzees in order to pick fruit from trees, and throw rocks at prey in order to injure it. We found a family of Baryonyx today. As it turns out, they're semi-aquatic, and use their tails to shoot through the water after fish, and chomp them up like a crocodile or gharials. They appear to be associating with a clan of Spinosaurus. Dr. Moore was very disappointed about seeing a live Spinosaurus, and I honestly can't blame him. They're mostly quadrapedal, and have feather covering more like ducks than anything else. Their skeletal structure is completely unsuited for walking upright, and the less said about the so-called spine, the better. Scientifically fascinating, but as a life-long dinosaur enthusiast, I must grieve for such a titan. We've made an incredible discovery: a four-winged flying dinosaur, with wings on both its arms and its legs. Weng speculates that it's a completely new species of Microraptor, native to Asia. It's colored like a raven, its plumage is an iridescent black. Since it's not been found in the record, it's a - α instance, and those things are tetchy. Weng nearly got his finger bitten off sedating it. If it's ever found in the fossil record, we'll name it properly, but for now, it's just Microraptor foundationii8. We finally found something that isn't feathered. It's a species of crocodile, Postosuchus, Late Triassic. It was drinking at the edge of a lake, when suddenly, a pack of Coelophysis jumped out and attacked it. Several of them went for its throat, cutting the jugular; as soon as it bled out, they began stripping the corpse to the bone. It was astounding, almost like piranha tearing apart a cow in the Amazon. We managed to collect the skeleton, and Weng noticed that the thing had three shattered ankles, as if they had fallen and landed on their feet; probably why the Coelophysis were able to take it down so easily. We saw a magnificent fight between a Therizinosaurus and a Carnotaurus. The Therizinosaurus practically decapitated the poor carnivore, which was about the same size; the Therizinosaur then did something rather odd: it cut open the Carnotaur's corpse and dipped its claws in the blood, before scoring the trees around it with dinosaur blood. I believe that this was done for the purpose of marking territory; it's actually rather fascinating, if somewhat gruesome. The Therizinosaur then ate a bit of flesh from the Carnotaur and left the area. Dr. Moore has apparently never seen a Dilophosaurus outside of a certain movie; he was absolutely shocked when he saw one, and it wasn't a 2-meter long creature that acted like a dog, but rather a 6-meter long creature that looked like it could bite off his head. It ran away, but we managed to get some good pictures. Also found some footprints from an unknown sauropod. I… honestly have no idea what on Earth we saw today. We found a new instance of SCP-1265-α. It appeared to be ceratopsid, with a single horn and four short, stumpy legs. But it had a long tail dragging along the ground, uncharacteristic of ceratopsids, and didn't have a frill of any sort; instead, it almost seemed to have floppy "ears" near the top of its head. It was also quite aggressive, and was engaged in combat with a Pachyrhinosaurus for unknown reasons; it ended up goring the poor thing. We decided to head back to the site after that. Footnotes 1. Objects such as SCP-346 suggest anomalies similar to SCP-1265 may exist elsewhere, though no additional instances have been found. 2. Roughly, "Large Python" 3. This is believed to be an exaggeration; to date, no record of instances of SCP-1265-A consuming humans has been found. 4. "One who blocks rivers" 5. Pei-Ji Chen was one of three paleontologists who described a fossil of Sinosauropteryx prima in a 1998 issue of Nature. The Yixian Formation in Lianoning, China, started producing fossil evidence of feathered dinosaurs in the 1990s, with Sinosauropteryx being one of the first to bear feather imprinting. 6. Clinical term for the spikes at the end of a stegosaurid's tail 7. In 1982, Dale Russell hypothesized that, if they had not gone extinct, Troodon would have evolved into a more humanoid form, known as a dinosauroid. There is no evidence to support this claim. 8. Fossils of this species were discovered in 2012, and the animal has since been publicly classified as M. hanqingi by Gong et. al. « SCP-1264 \| SCP-1265 \| SCP-1266 » _ccaliveanimaldinosaureuclidlocationscptemporal page revision: 39, last edited: 07 Jan 2025 19:00 Edit Rate (+350) Tags Discuss (68) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1266 rating: +170+–x Item #: SCP-1266 Object Class: Euclid Special Containment Procedures: As SCP-1266 is immobile, it is contained on-site under a sealed terrarium dome 100 m in diameter in order to isolate it from the Earth's atmosphere. All structural components of the primary dome must be checked weekly for deterioration or corrosion, and damaged sections must be sealed and repaired immediately. All personnel entering SCP-1266's containment dome must wear full-body, self-contained hazardous material suits and must undergo complete decontamination when entering or leaving the sealed containment area. All equipment used must also be decontaminated. Specimens of all flora and fauna collected from SCP-1266's vicinity are kept in the site's main laboratory. Description: SCP-1266 is an engraved metallic ovoid object approximately 12 m in length and 7 m in width, located at a former paleontology dig site in [REDACTED], P. R. China. Attempts to date the artifact have met with only limited success as all attempts to sample its surface material have failed thus far; however, through dating the surrounding strata and analysis of its primary effect, it is suggested that SCP-1266 is at least two hundred and fifty two (252) million years old, placing its presence on Earth to just prior to the Permian-Triassic extinction event. SCP-1266 was unearthed by paleontologists on [REDACTED]. Shortly after being unearthed, SCP-1266 activated and levitated into the air, orienting itself vertically where it has remained ever since. SCP-1266 has completely resisted any attempt to move it, but has exhibited the following traits to date: SCP-1266 continuously processes surrounding air, altering its chemical and organic balance to what is believed to be Earth norm near the end of the Permian geological period. SCP-1266 produces and releases seeds for many extinct terrestrial plant genera, most notably Cordaites and Glossopteris. SCP-1266 produces and releases live specimens of terrestrial invertebrates, such as extinct Palaeodictyopteroids. SCP-1266 produces and releases live specimens of terrestrial vertebrate animals, such as extinct labyrinthodont amphibians, sauropsids, and therapsids, most notably large numbers of Lystrosaurus herbivores. It is currently unknown whether SCP-1266 is somehow fabricating these specimens from stored genetic data, or releasing them from some form of stasis in internal storage. At the time of this writing, SCP-1266's containment dome has stabilized into a self- contained, self-sustaining ecology populated with Permian wildlife. To date, attempts to open, disable, or take samples of SCP-1266 have failed, as no means available to the Foundation appear to be capable of manipulating or damaging • • • • the object. Ultrasonic, spectroscopic, and [REDACTED] analysis suggest that SCP-1266 may have an inconsistent internal topography, and gravimetric measurements taken from SCP-1266's vicinity seem to indicate that the object may exceed ███,███ tonnes in weight. Excavation of the surrounding site has uncovered no additional artifacts at the same level as SCP-1266, and attempts to decipher the inscriptions on SCP-1266 are ongoing. At this time, it is still not known how it was created or what caused it to activate. Addendum 1266-01: Observer Note The request to use military-grade weapons in an attempt to breach SCP-1266's surface has been denied, as it presents too much risk to the object and the scientific value it holds. Until a better understanding of its function and/or a way to safely deactivate it is found, all such requests will continue to be denied. Dr. █████████ Senior Observer « SCP-1265 \| SCP-1266 \| SCP-1267 » ‡ Licensing / Citation Cite this page as: "SCP-1266" by Aelanna, from the SCP Wiki. Source: https://scpwiki.com/ scp-1266. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxairborneartifactectoentropiceuclidimmobileindestructibleinscriptionscp page revision: 12, last edited: 21 Oct 2022 08:34 Edit Rate (+170) Tags Discuss (29) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1267 rating: +162+–x Item #: SCP-1267 Object Class: Euclid Special Containment Procedures: SCP-1267 is currently maintained in the large animal wing of Site-12, in a 10m by 15m enclosure recessed 3m below an encircling observation walkway. Separating the observation area from the enclosure is a 2m fence of reinforced steel and synthetic netting, which also encloses the roof. At least two Level-2 veterinary doctors familiar with mammalian biology and animal husbandry are assigned to SCP-1267, one of whom must be on site at all times. SCP-1267 is to undergo bi-weekly examination by sonogram and x-ray. When necessary, the supervising doctor is to be the primary designator of any new containment procedures required. Access to SCP-1267 requires clearance from the supervising doctor. Personnel assigned to SCP-1267 are reminded that each instance of SCP-1267 is effectively a new, untamed organism. Description: SCP-1267 is a mammalian organism, which as of 6/9/20██ resembles an adult female pronghorn antelope. Thus far, attempts at interbreeding or crossbreeding SCP-1267 with common stock have failed to produce viable offspring. All observed instances of SCP-1267 to date have been female. SCP-1267 is effectively indistinguishable from its "template" species. SCP-1267 will periodically undergo an event which resembles the incomplete metamorphosis that occurs in some orders of arthropod. This process appears to occur only after the organism has reached an age at which its template species would achieve sexual maturity. Metamorphosis has also been induced in two cases (See Experiment 1267B summary). During metamorphosis, SCP-1267 displays behavior consistent with a gravid female of its template species. However, ultrasound reveals that up to 90% of the tissue in its thoracic and abdominal cavities undergoes a radical alteration into what is effectively a second, fetal organism - designated SCP-1267-1 - resembling a different template mammalian species. On ██ occasions this alteration has included the effective destruction of vital respiratory, circulatory, and/or digestive systems without any apparent negative effect on SCP-1267. The form taken by SCP-1267-1 thus far appears to be constrained to template species whose size at birth is no greater than the dimensions of SCP-1267 itself. SCP-1267 enters the final phase of metamorphosis when SCP-1267-1 either reaches full adult growth (Type 1) or completely fills the thoracic and abdominal cavities of SCP-1267 (Type 2). At this point SCP-1267 will become visibly distressed and show signs of disorientation. Within three hours of onset, SCP-1267-1 (hereby designated SCP-1267) will violently emerge from the previous organism's body, which it will then consume, regardless of template species’ normal dietary habits. An instance of SCP-1267 produced by Type 1 metamorphosis is completely autonomous upon emergence. An instance produced by Type 2 metamorphosis may be in a juvenile or even infantile developmental stage, and may require additional care accordingly. See Table 1267A for full documentation of observed metamorphic events by SCP-1267. Addendum 1267A: Updated containment procedures Given the nature of metamorphic event 14, SCP-1267 is to be contained at a coastal Foundation facility that meets Protocol 173 standards for oceanic creature containment. Experiment 1267A - ██/██/19██, Site 25 Objective: Determine reproductive capability of SCP-1267. Procedure: A male California ground squirrel is introduced to the enclosure containing SCP-1267 (currently resembling a female California ground squirrel), and the two are allowed to copulate multiple times over a one- month period. Result: SCP-1267 fails to become pregnant. It is hypothesized that SCP-1267 cannot reproduce by conventional means. Experiment 1267B - ██/██/19██, Site 25 Objective: In light of the events immediately following SCP-1267's retrieval, investigate alternate triggering stimuli for metamorphosis. Procedure A: A digit is surgically removed from each of SCP-1267's (currently resembling a grey-headed flying fox) hind limbs. Result: SCP-1267 does not enter its metamorphic state. Procedure B: A digit is surgically removed from each of SCP-1267's forelimbs, rendering it flightless. Result: Onset of metamorphosis is observed via ultrasound approximately 36 hours after SCP-1267 awakens following Procedure B. It is hypothesized that SCP-1267 will enter the metamorphic state in response to crippling trauma. Experiment 1267C - ██/██/19██, Site 12 Objective: Investigate the potential for reproduction of SCP-1267 via nontraditional methods. Procedure: Nuclei from mammary cells harvested from SCP-1267 (currently resembling a grey wolf) are transferred to enucleated egg cells from a donor grey wolf, and the resulting eggs are implanted into three gestational surrogates: three in one, five in the second, and four in the third. Result: All three gestational surrogates miscarried. None of the eggs implanted in surrogates 2 and 3 progressed past the blastocyst stage. The fetuses carried by surrogate 1 showed felid, hippopotamid, and █████ characteristics, respectively. Additional research into cloning is recommended. Psychiatric Evaluation, Personnel 1267-53 + Confidential, Level 4 clearance required. Interviewed: Dr. A██████, 2/1267-53 Interviewer: Dr. L████████ Forward: Dr. A██████ was referred for psychiatric evaluation following Event 1267-23. <Begin Log> Dr. L████████: Good afternoon, Doctor. Please have a seat. I understand you’ve been having difficulty sleeping; would you like to talk about what’s bothering you? Dr. A██████: I think I just need to get it off my chest – ever since the last metamorphic event with SCP-1267. Dr. L████████: What about it? Dr. A██████: None of us— well, I think we all knew it could happen, eventually. Probably just didn’t want to consider having to actually deal with it. Dr. L████████: You’re speaking of… Ah, I see - the latest instance of SCP-1267. Dr. A██████: Have you seen the drawings she's making? She remembers, man! Every single metamorphosis, probably hundreds of them. She’s like twelve years old! And the latest ultrasounds… oh god. It’ll rip her in half. Dr. L████████: Doctor A██████, this is neither the first nor the last time the Foundation will be required to keep a humanoid SCP in containment. If you are unwilling or unable to continue your duties with SCP-1267, I can recommend that you be reassigned. If you wish, I can also put in a request to the Site Administrator for a Class-C amnestic. <End Log> « SCP-1266 \| SCP-1267 \| SCP-1268 » ‡ Licensing / Citation Cite this page as: "SCP-1267" by coil780, from the SCP Wiki. Source: https://scpwiki.com/ scp-1267. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxanimalbiologicaleuclidmetamorphicscp page revision: 12, last edited: 21 Oct 2022 09:12 Edit Rate (+162) Tags Discuss (39) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1268 rating: +110+–x Item #: SCP-1268 Object Class: Safe-exsequi Special Containment Procedures: SCP-1268 is to be kept in a standard humanoid containment cell and fed regularly. The room is to be monitored by one guard at all times. In the event of a containment breach, security personnel are required to detain SCP-1268 alive if at all possible; however, if personnel deem SCP-1268 an imminent risk, they are permitted to dispose of it by any means necessary. Description: SCP-1268 is a human male of indeterminate race with brown eyes and black hair. While SCP-1268 is capable of basic motor functions and self-maintenance, it does not appear to be capable of communication, nor does it show signs of emotion or higher intelligence. It is currently believed to be nonsapient; however, it has demonstrated the ability to use stairs, door handles, and elevators. When left to its own devices, SCP-1268 will wander aimlessly until it is in proximity to a large group of people1; in these situations, SCP-1268 will go into the crowd and slowly move through it. During this process, the behavior of those in the group will be altered in a predictable manner: 0 min to 2 min: No effects are visible. 2 min to 7 min: Persons in the crowd are visibly nervous, turning their heads frequently and moving more quickly than before SCP-1268 entered the crowd. 7 min to 14 min: Persons other than SCP-1268 begin to experience disorientation and confusion. Some will actively attempt to exit the crowd, although most will continue with whatever activities they were participating in. 14 min forward: Almost all persons in the crowd panic and attempt to leave the area by any means necessary. Subjects affected this way show a distinct lack of concern for the safety of themselves and others. Anomalous effects will cease after SCP-1268 is no longer in the crowd. The danger of SCP-1268 varies with group size, group density, accessibility of exits, and size of exits. On average, 30% of all persons in a group that has been affected by SCP-1268 will be killed from being trampled or from interpersonal violence. A further 35% will suffer injuries of various severity. SCP-1268 will remain unharmed and show no apparent reaction to the event. Addendum: A review of available footage has found that, when in a crowd for fourteen minutes or more, SCP-1268 will exhibit a behavior that may or may not be laughter. Footnotes 1. Due to the inherent expense of testing SCP-1268’s capabilities, the exact group size and conditions necessary to trigger SCP-1268’s anomalous effects is unknown. The phenomenon has been observed to occur in groups as small as 35. • • • • « SCP-1267 \| SCP-1268 \| SCP-1269 » ‡ Licensing / Citation Cite this page as: "SCP-1268" by Communism will win, from the SCP Wiki. Source: https:// scpwiki.com/scp-1268. Licensed under CC-BY-SA. For information on how to use this component, see the License Box component. To read about licensing policy, see the Licensing Guide. _licenseboxhumanoidmind-affectingsafescp page revision: 16, last edited: 20 Oct 2022 21:36 Edit Rate (+110) Tags Discuss (46) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.
SCP Foundation Secure, Contain, Protect About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Contact Us ≡ About About Us Site Rules FAQ Licensing Criticism Policy Article Deletions Contact Staff Community Site News IRC Chat Authors' Pages Artist Directory Contest Archive Staff List Resources Guides Search this site Search • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ • ◦ ◦ • • ◦ ◦ ◦ ◦ ◦ ◦ ◦ • ◦ ◦ ◦ ◦ ◦ ◦ • ◦ Essays & Resources Wiki Syntax Sandbox Usertools Sister Sites SCP International Wanderer's Library Create account or Sign in Getting Started Guide for Newcomers Join the Site Contribute \| FAQ Universe Hub Main \| Forum SCP by Series I \| II \| III \| IV \| V VI \| VII \| VIII \| IX Other SCP Explained \| Joke International Feed New Pages Shortest \| Top Rated Recent Changes New Forum Posts Lowest Rated Pages Stories Tales Hub \| Series Groups of Interest GoI Formats Canon Hub Discovery Artwork Hub Curated Lists Curated Tale Series Tag Search Random SCP \| Tale \| GOI \| Art Random Page ◦ ◦ ◦ ◦ • ◦ ◦ SCP-1269 rating: +371+–x Item #: SCP-1269 Object Class: Euclid Special Containment Procedures: The property where SCP-1269 is located is to remain under the custody of the Foundation. No females 23 years of age or over are to enter the property except for testing purposes. One male researcher is to reside within the property under the guise of the current resident, and is to monitor the behavior of SCP-1269. Description: SCP-1269 is a black, aluminum curbside mailbox, possessing a red flag and a white, plastic post. SCP-1269 stands 1.3m tall, with the mailbox measuring 49.5cm x 15.2cm x 17.7cm, consistent with the T2 mailbox size in the United States. The number ███ is printed on the right side. It lacks any manufacturer's marks, and has minor dents and abrasions, suggesting the object has been present on the same property for some time. Due to the nature of SCP-1269's effect, the object is permanently located in ████████, Massachusetts in front of house number ███ on ███████ Avenue. SCP-1269's anomalous properties will manifest only when a single female 23 years or older (hereafter referred to as "the occupant") resides within the same property as SCP-1269. Approximately two weeks after the occupant moves in, SCP-1269 will start to manifest unaddressed letters every four days. The contents of the letter are romantic in nature, and are targeted towards the occupant of the house. Surveillance within SCP-1269 has shown the letters manifest approximately three seconds after the occupant's mail has been delivered. Exactly three weeks after the appearance of the first letter, SCP-1269's secondary anomalous properties will manifest. Letters will begin appearing daily, with contents becoming increasingly more obsessive and erratic, until the point that letters regress into single sentences. In some occasions, multiple letters will appear within SCP-1269. Additionally, when not under direct supervision of the occupant, SCP-1269 will teleport to a location near the occupant and face them. This location will be partially obstructed, such as behind windows, cracked doors, and shower curtains. Under special circumstances, such as during sleep or when obscured by darkness, SCP-1269 will teleport near the occupant without obstruction. Whether or not the occupant relocates SCP-1269, the object will continue to teleport between a range of one to five times every twelve hours. SCP-1269 will not follow the occupant off the property, and all anomalous properties will cease manifesting after the occupant has either moved or expired. Attempts to remove SCP-1269 from its location have so far been unsuccessful. SCP-1269 will teleport to its original curbside location after one hour of relocation. If attempts are made to replace SCP-1269 with a new mailbox, the mailbox will be teleported away with SCP-1269 appearing in its place. Approximately three hours after the disappearance of the new mailbox, it will reappear in a dumpster 25km away behind an abandoned ███████ franchise. Mailboxes recovered so far have all been found in varying amounts of disrepair, within garbage bags, and covered in painted-on words and phrases. Addendum SCP-1269-A: On 07/12/04, D-69124, a male, was moved onto the property with the current test occupant, D-72803, after seven weeks had passed. SCP-1269 stopped teleporting at this time. Three days later, D-69124 disappeared from the property, causing SCP-1269 to resume all anomalous behavior. Two weeks after disappearance, D-69124 was found in similar location as other replacement mailboxes. The subject was found within a large garbage bag with severe bruising and lacerations, an apparently fatal blow to the head, and a lack of hands and lips. See Documents SCP-1269-B for recorded phrasing. Documents SCP-1269-A Transcribed below are several letters delivered to D-871523, who temporarily resided within the property of SCP-1269 for testing. 07/21/98 I remember the day, the hour, the infinitesimal sliver of a second when I fell in love with you, realized I loved you and only you, the moment my heart stopped and I lived for you alone. Perhaps it was the way you carried yourself on the tired days, perhaps it was the way your eyes shone when a transient beauty crossed your path; would you understand how I longed to be that butterfly dancing on the afternoon breeze, that small flower struggling through sidewalk cracks, that passing swanlike cloud in the sky, how I longed to be anything that would catch your eye and move your smile? You pass by me each day, never sparing me more than a glance, but for me it is enough to carry me until the next day, as I wait to next catch a glimpse of you and your unearthly beauty, your charming laugh and graceful step. I love the way you dance whenever you walk, I love the way you tilt your head towards the sun, I love everything about you, I love you. 08/09/98 How could anyone describe one as perfect as you, vision of elegance and loveliness? Every action of yours I’ve observed is embodied in the fragility and delicacy of a twirling snowflake, and yet you waltz into eternity with the softest of motion, in perfect rhythm with the air and the world. You are beautiful. Every step, every pause, every breath of yours is a masterwork of the divine. Your presence brightens the world with a light that cannot be compared, you are the flower that nature cannot hope to match. 08/15/98 The color of your eyes reminds me of the depth and expanse of the night sky, a vast dazzling macrocosm of soft velvet and glimmering pinpricks of light. 8/18/98 Do you sing in the shower? If so, I’ve heard you. Such a tenderly beautiful voice matches its owner. 8/21/98 I think of you and nothing but you as the day flows by, I yearn for a faint shimmer of your face as everything darkens to night 8/24/98 The wind was blowing and I thought it whispered your name sadly because that is what my heart is doing please write back I keep thinking of the way your hair shines softly in the evening light, as if each strand is a shaft of purest moonbeams please write 8/26/98 The trees drop their leaves and cry with me as I stand here alone, without you please write xoxoxo My shadow grows longer as if reaching towards you please write xoxoxo I miss the light in your eyes and the harmony of your voice please write xoxoxo Documents SCP-1269-B Transcribed below are various phrases written on mailboxes disposed of by SCP-1269. SHE'S MINE SHE'S MINE SHE'S MINE SHE'S MINE YOU CAN'T HAVE HER SHE'S MINE SHE'S MINE FUCK YOU YOU PILE OF PLASTIC AND WOOD SHE IS MY EVERYTHING YOU ARE NOTHING TO HER IT WAS A FLING AND I KNOW IT I'M DOING HER A FAVOR NO NO NO NO NO NO NO YOU CAN'T HAVE HER NO NO NO I WON'T LET YOU NO NO NO NO WHO CARES IF YOUR FLAG IS BIGGER THAN MINE I KNOW SHE DOESN'T CARE SHE ONLY SEES THE GOOD IN PEOPLE AND YOU ARE FULL OF SHIT YOU FUCKER I KNOW SHE LOVES ME IT'S OKAY BABY IT'S OKAY I LOVE YOU TOO AND WE'LL BE TOGETHER FOREVER AND EVER YOU ARE NOTHING BUT A TOOL FOR HER USE BUT I AM MORE I AM HER EVERYTHING AS SHE IS MINE SHE USED YOU SHE USED YOU SHE USED YOU AND NOW YOU'RE WHERE YOU BELONG (see Addendum SCP-1269-A) WHAT IS A MAN BUT A PILE OF SHIT THAT GETS IN THE WAY OF MY LOVE HOW CAN SHE EVER LOVE YOU WHEN YOU'RE SO EASILY BROKEN SHE NEVER EVEN LET YOU TOUCH HER I SAW THE WAY SHE LOOKED AT YOU WITH HATRED AND NOW SHE WILL LOVE ME FOREVER « SCP-1268 \| SCP-1269 \| SCP-1270 » artifactco-authoredectoentropiceuclidscptelekineticteleportation page revision: 18, last edited: 01 Oct 2022 11:12 Edit Rate (+371) Tags Discuss (74) History Files Print Site tools + Options Edit Sections Append Edit Meta Watchers Backlinks Page Source Parent Lock Page Rename Delete Help \| Terms of Service \| Privacy \| Report a bug \| Flag as objectionable Powered by Wikidot.com Unless otherwise stated, the content of this page is licensed under Creative Commons Attribution-ShareAlike 3.0 License Click here to edit contents of this page. Click here to toggle editing of individual sections of the page (if possible). Watch headings for an "edit" link when available. Append content without editing the whole page source. Check out how this page has evolved in the past. If you want to discuss contents of this page - this is the easiest way to do it. View and manage file attachments for this page. A few useful tools to manage this Site. See pages that link to and include this page. Change the name (also URL address, possibly the category) of the page. View wiki source for this page without editing. View/set parent page (used for creating breadcrumbs and structured layout). Notify administrators if there is objectionable content in this page. Something does not work as expected? Find out what you can do. General Wikidot.com documentation and help section. Wikidot.com Terms of Service - what you can, what you should not etc. Wikidot.com Privacy Policy.

Subsets and Splits

No community queries yet

The top public SQL queries from the community will appear here once available.