Dataset Viewer
Auto-converted to Parquet
inputs
stringlengths
55
647
labels
stringlengths
29
655
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [biological_process] <extra_id_2> [sequence] MNWTVDIPIDQLPSLPPLPTDLRTRLDAALAKPAAQQPTWPADQALAMRTVLESVPPVTVPSEIVRLQEQLAQVAKGEAFLLQGGDCAETFMDNTEPHIRGNVRALLQMAVVLTYGASMPVVKVARIAGQYAKPRSADIDALGLRSYRGDMINGFAPDAAAREHDPSRLVRAYANASAAMNLVRALTSSGLASLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACGVADRNLQTAEIYASHEALVLDYERAMLRLSDGDDGEPQLFDLSAHTVWIGERTRQIDGAHIAFAQVIANPVGVKLGPNMTPELAVEYVERLDPHNKPGRLTLVSRMGNHKVRDLLPPIVEKVQATGHQVIWQCDPMHGNTHESSTGFKTRHFDRIVDEVQGFFEVHRALGTHPGGIHVEITGENVTECLGGAQDISETDLAGRYETACDPRLNTQQSLELAFLVAEMLRD
<extra_id_0> Peptidoglycan-based cell wall ### Cytosol ### Plasma membrane <extra_id_1> Manganese ion binding <extra_id_2> Amino acid biosynthetic process ### Protein homooligomerization ### Aromatic amino acid family biosynthetic process ### Chorismate biosynthetic process <extra_id_3>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [sequence] ILGTILGLLKGL
<extra_id_0> Defense response to fungus ### Innate immune response ### Chemotaxis ### Defense response to bacterium ### Killing of cells of another organism <extra_id_1> Extracellular region ### Membrane ### Other organism cell membrane <extra_id_2> Toxin activity <extra_id_3>
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] MKTKAAVLFETHKPFEIVELEL
<extra_id_0> Oxidoreductase activity <extra_id_1> Cytoplasm <extra_id_2>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [sequence] AYDPDPYKRYSAEHTFFLL
<extra_id_0> Proteolysis <extra_id_1> Extracellular region <extra_id_2> Metalloendopeptidase activity ### Metallopeptidase activity ### Toxin activity ### Zinc ion binding <extra_id_3>
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] PTSQPRGDPTGPKE
<extra_id_0> Metal ion binding ### Rna binding <extra_id_1> Host cell nucleolus ### Host cell cytoplasm ### Extracellular region <extra_id_2>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] MAMSNTSALASKLLPSCKPHQPTLTFFSPSTTCQKKPRSSRPISAAVHVTQPPKTPISSATATKRRLSLLNGVWESWKSKKALQLPEYPDEGKLDGVLKTIEAFPPLVFAGEARSLEEKLAQAAMGNAFLLQGGDCAESFKELMPLYSRYFQNTASDECRLTFGGQCPVIKVGRMAGQFAKPRLDPFEEKDGLWLSGANGWPVAWEAYCKLQQLSPSRALLLVVCCYAESHPMDLDFVEHSEQGDRYQELAHRVDEALGFMDACGLTVDHPIMATTEFWTSHECLLLPYEQALTREDSTSGLFYDCSAHMLWVGERTRQLDGAHVEFLRGVANPLGIKVSQKMDPNELVNLIEILNPTNKPGRITVIVRMGAENMRVKLPHLIRAVRGAGQIVTWVCDPMHGNTIKAPCGLKTRAFDAILAEVRAFYDVHEQEGTLPGTECVGGSRTITYDDRQTRYHTHCDPRLNASQSLELAFIIAERLRKEESVLNAHSP
<extra_id_0> Amino acid biosynthetic process ### Chorismate biosynthetic process ### Aromatic amino acid family biosynthetic process <extra_id_1> Chloroplast <extra_id_2>
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [biological_process] <extra_id_2> [sequence] MNWTVDIPIDQLPPLPPLSDELRQRLDSALAKPAVQQPSWDPDAAKAMRTVLESVPPVTVPSEIEKLKGLLADVAQGKAFLLQGGDCAETFVDNTEPHIRANIRTLLQMAVVLTYGASMPVVKVARIAGQYAKPRSSDVDALGLKSYRGDMINGFAPDAAAREHDPSRLVRAYANASAAMNLMRALTSSGLASLHLVHEWNREFVRTSPAGARYEALAGEIDRGLNFMSACGVADRNLQTAEIFASHEALVLDYERAMLRLSNPAETDGAAKLYDQSAHYLWIGERTRQLDGAHVAFAEVIANPIGVKLGPTTTPELAVEYVERLDPNNEPGRLTLVTRMGNNKVRDLLPPIIEKVQATGHQVIWQCDPMHGNTHESSTGYKTRHFDRIVDEVQGFFEVHHALGTHPGGIHVEITGENVTECLGGAQDISDSDLAGRYETACDPRLNTQQSLELAFLVAEMLRD
<extra_id_0> Manganese ion binding <extra_id_1> Plasma membrane <extra_id_2> Amino acid biosynthetic process ### Chorismate biosynthetic process ### Aromatic amino acid family biosynthetic process <extra_id_3>
[biological_process] <extra_id_0> [sequence] LYKLVKVVLNM
<extra_id_0> Defense response to gram-negative bacterium ### Defense response to fungus ### Defense response to gram-positive bacterium ### Killing of cells of another organism <extra_id_1>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] AYRKPPFNGSIF
<extra_id_0> Extracellular region <extra_id_1> Neuropeptide signaling pathway <extra_id_2>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] GLGNNAFLGVR
<extra_id_0> Neuropeptide signaling pathway <extra_id_1> Extracellular region <extra_id_2>
[biological_process] <extra_id_0> [sequence] YSKSLPLSVLNP
<extra_id_0> Defense response to gram-positive bacterium ### Defense response to gram-negative bacterium <extra_id_1>
[molecular_function] <extra_id_0> [sequence] ATFDIVNQCTFT
<extra_id_0> Hydrolase activity, acting on glycosyl bonds <extra_id_1>
[biological_process] <extra_id_0> [family] <extra_id_1> [cellular_component] <extra_id_2> [molecular_function] <extra_id_3> [sequence] GSNTECFWKYCV
<extra_id_0> Regulation of blood pressure <extra_id_1> Urotensin ii <extra_id_2> Extracellular region <extra_id_3> Hormone activity <extra_id_4>
[family] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [biological_process] <extra_id_3> [sequence] GGNTECFWKYCV
<extra_id_0> Urotensin ii <extra_id_1> Extracellular region <extra_id_2> Hormone activity <extra_id_3> Regulation of blood pressure <extra_id_4>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] SPSNSKCPDGPDCFVGLM
<extra_id_0> Extracellular region <extra_id_1> Neuropeptide signaling pathway <extra_id_2>
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] KDGYPVDNANCKYE
<extra_id_0> Toxin activity ### Sodium channel regulator activity ### Ion channel inhibitor activity <extra_id_1> Extracellular region <extra_id_2>
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [cellular_component] <extra_id_2> [sequence] QWPDPSSDIPP
<extra_id_0> Toxin activity <extra_id_1> Regulation of blood pressure <extra_id_2> Extracellular region <extra_id_3>
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] DEGCLPDDSSRT
<extra_id_0> Extracellular region <extra_id_1> Toxin activity <extra_id_2>
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [cellular_component] <extra_id_2> [sequence] QARPRPGPKIPP
<extra_id_0> Toxin activity <extra_id_1> Regulation of blood pressure <extra_id_2> Extracellular region <extra_id_3>
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [cellular_component] <extra_id_2> [sequence] QARPRPGPKIPP
<extra_id_0> Toxin activity <extra_id_1> Regulation of blood pressure <extra_id_2> Extracellular region <extra_id_3>
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] SIVLRGKAPFR
<extra_id_0> Toxin activity <extra_id_1> Extracellular region <extra_id_2>
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] LECNKLVDIAYITCPAGKNL
<extra_id_0> Extracellular region ### Membrane ### Other organism cell membrane <extra_id_1> Toxin activity <extra_id_2>
[biological_process] <extra_id_0> [molecular_function] <extra_id_1> [cellular_component] <extra_id_2> [sequence] INWLKLGKKILGAL
<extra_id_0> Defense response to bacterium <extra_id_1> Toxin activity <extra_id_2> Extracellular region ### Membrane ### Other organism cell membrane <extra_id_3>
[cellular_component] <extra_id_0> [sequence] PRLRRLTGLSPLRAP
<extra_id_0> Extracellular region <extra_id_1>
[cellular_component] <extra_id_0> [sequence] FDLGMLVKKVLAGL
<extra_id_0> Extracellular region ### Membrane ### Other organism cell membrane <extra_id_1>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [molecular_function] <extra_id_2> [sequence] INWLKLGKKILGAI
<extra_id_0> Extracellular region ### Membrane ### Other organism cell membrane <extra_id_1> Killing of cells of another organism <extra_id_2> Toxin activity <extra_id_3>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] QGVBBBZGLFSAR
<extra_id_0> Adaptive immune response ### Innate immune response ### Blood coagulation <extra_id_1> Extracellular region <extra_id_2>
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [biological_process] <extra_id_2> [sequence] FLPLILGKLVKGLL
<extra_id_0> Toxin activity <extra_id_1> Extracellular region <extra_id_2> Chemotaxis <extra_id_3>
[cellular_component] <extra_id_0> [sequence] AADIFAKFKTSMEVK
<extra_id_0> Cytoplasm <extra_id_1>
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] VATFTLPDLPYDYGALEPAV
<extra_id_0> Metal ion binding ### Superoxide dismutase activity <extra_id_1> Mitochondrial matrix <extra_id_2>
[cellular_component] <extra_id_0> [sequence] ATVVAPKYTAIKPLGDRVLVK
<extra_id_0> Chloroplast <extra_id_1>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] MALSNTLSLSSSKSLVQSHLLHNPTPQPRFSLFPTTQHGRRHPISAVHAAEPSKTAVKQGKWSLDSWKTKKALQLPEYPDEKELESVLKTLEMNPPLVFAGEARSLEEKLGEAALGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMSVVLMFGGQVPVIKVGRMAGQFAKPRSDPFEEINGVKLPSYKGDNINGDTFDEKSRIPDPHRLIRAYMQSAATLNLLRAFATGGYAAMQRVTEWNLDFVENSEQGDRYQELAHRVDEALGFMAAAGLTVDHPIMSTTDFWTSHECLLLPYEQALTREDSTSGLFYDCSAHMVWVGERTRQLDGAHVEFLRGVANPLGIKVSQKMDPKELIKLIDILNPANKPGRITVIVRMGAENMRVKLSHLVRAVRGAGQIVTWVCDPMHGNTIKAPCGLKTRAFDSIQAEVRAFFDVHEQEGSHPWCIHLEMTGQNVTECIGGSRTVTYDDLGSRYHTHCDPRLNASQSLELSFIVAERLRRRRMSSQRL
<extra_id_0> Chloroplast <extra_id_1> Amino acid biosynthetic process ### Chorismate biosynthetic process ### Aromatic amino acid family biosynthetic process <extra_id_2>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] MALSNTLSLSSSKSLVQSHLLHNPLPQPRFSLFPTTQHGRRHPISAVHAAEPSKTAVKQGKWSLDSWKTKKALQLPEYPDEKELESVLKTLEMNPPLVFAGEARSLEEKLGEAALGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMSVVLMFGGQVPVIKVGRMAGQFAKPRSDPLEEINGVKLPSYKGDNINGDTFDEKSRIPDPHRLIRAYMQSAATLNLLRAFATGGYAAMQRVTEWNLDFVENCEQGDRYQELAHRVDEALGFMAAAGLTVDHPIMSTTDFWTSHECLLLPYEQALTREDSTSGLFYDCSAHMVWVGERTRQLDGAHVEFLRGVANPLGIKVSQKMDPNELIKLIDILNPANKPGRITVIVRMGAENMRVKLSHLVRAVRGAGQIVTWVCDPMHGNTIKAPCGLKTRAFDSILAEVRAFFDVHEQEGSHPGGIHLEMTGQNVTECIGGSRTVTYDDLGSRYHTHCDPRLNASQSLELSFIVAERLRRRRMSTQRL
<extra_id_0> Chloroplast <extra_id_1> Amino acid biosynthetic process ### Chorismate biosynthetic process ### Aromatic amino acid family biosynthetic process <extra_id_2>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] QPNPDEFVGLM
<extra_id_0> Defense response ### Neuropeptide signaling pathway <extra_id_1> Extracellular region <extra_id_2>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] VELQNRLSDESQ
<extra_id_0> Microtubule ### Golgi apparatus <extra_id_1> Endosome organization ### Lysosome organization ### Protein transport <extra_id_2>
[biological_process] <extra_id_0> [sequence] MTVNAKTSPSAGNTWRDLPAAQQPEYPDTEALRAVIADLESYPPLVFAGECDQLRARMAAVAKGEAFLLQGGDCAEAFDAVSADHIRNKLKTLLQMGAVLTYAASVPVVKVGRIAGQYSKPRSKPTETRDGVTLPTYRGDSVNGFDFTEAARIPDPERLKRMYHASASTLNLVRAFTTGGYADLRQVHAWNQDFVKSSPSGQRYEQLAREIDNALNFMRACGTDPAEFQTVEFFSSHEALLLDYESALTRVDSRTGQLYDVSGHMVWIGERTRQLDHAHIEFASRIRNPIGIKLGPSTTAEEALQYIERLDPEREPGRLTFIVRMGADKIRDKLPELVEKVTASGATVAWITDPMHGNTYEAASGHKTRRFDDVLDEVKGFFEVHKSLGTHPGGIHVELTGDDVTECVGGGDEIFVDDLHQRYETACDPRLNRSQSLDLAFLVAEMYRDQ
<extra_id_0> Amino acid biosynthetic process ### Chorismate biosynthetic process ### Aromatic amino acid family biosynthetic process <extra_id_1>
[biological_process] <extra_id_0> [sequence] TRRFDDVLDEVKGFFEVH
<extra_id_0> Amino acid biosynthetic process ### Chorismate biosynthetic process ### Aromatic amino acid family biosynthetic process <extra_id_1>
[biological_process] <extra_id_0> [sequence] MSQQTTPNAPGWAPDSWRSKPIKQCPEYPDKAALEKATNELKTLPPIVLPNEIIRLREHLRDVAQGKAFLLQGGDCAELFSYCQQDVIESKIKLLLQMSLVLLWGADKPVVRIGRMAGQYAKPRSSPVETINGKEVPSFRGDILNGFHPDERELDPNRLVRAYQYSSATLNYIRGAIGSGIADLHGPLDWGLGHVRDPALKSKYQETVDRIQEMLRFMHTIGADQNEKLSTVELFTSHEGLLLEYEEPLTRLLNHPSVRSYPPDSTTPPKKEYYNTSAHFLWIGDRTRQIDHAHVEYFRGIANPIGVKIGPSTPTSDLLPMLRTLNPNREPGKVTLITRYGADKVASLLPAHIRTVESSEYARTVVWQCDPMHGNTQSVSGGIKTRKFSDIFSELQQTLRIHKEEKSYLGGMHLELTGDAVTECLGGGAGLDEDDLSTNYTSFCDPRLNEKQALELAFLVADHYRQERKEKEAERRKSSVV
<extra_id_0> Amino acid biosynthetic process ### Chorismate biosynthetic process ### Aromatic amino acid family biosynthetic process <extra_id_1>
[molecular_function] <extra_id_0> [sequence] VRPYLVAFYESH
<extra_id_0> Rna nuclease activity <extra_id_1>
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [sequence] AYVSQSGAPWGLGRISHK
<extra_id_0> Serine-type peptidase activity <extra_id_1> Proteolysis <extra_id_2>
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [cellular_component] <extra_id_2> [sequence] ATVQGGIXYRMP
<extra_id_0> Peptidase activity <extra_id_1> Proteolysis ### Defense response to bacterium ### Killing of cells of another organism <extra_id_2> Extracellular region <extra_id_3>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] MVTLNASSPLTTKSFLPYRHAPRRPISFSPVFAVHSTDPKKSTQSASASVKWSLESWKSKKALQLPDYPDQKDVDSVLQTLSSFPPIVFAGEARKLEDKLGQAAMGQAFMLQGGDCAESFKEFNANNIRDTFRVLLQMGVVLMFGGQLPVIKVGRMAGQFAKPRSDPFEEKDGVKLPSYRGDNINGDAFDEKSRIPDPHRMVRAYTQSVATLNLLRAFATGGYAAMQRVSQWNLDFTQHSEQGDRYRELANRVDEALGFMGAAGLTSAHPIMTTTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMLWVGERTRQLDGAHVEFLRGIANPLGIKVSDKMVPSELVKLIEILNPQNKPGRITVIVRMGAENMRVKLPNLIRAVRGAGQIVTWVSDPMHGNTIMAPGGLKTRSFDAIRAELRAFFDVHDQEGSFPGGVHLEMTGQNVTECVGGSRTITYNDLSSRYHTHCDPRLNASQSLELAFIIAERLRKRRLGSGNLPSSIGV
<extra_id_0> Amino acid biosynthetic process ### Chorismate biosynthetic process ### Aromatic amino acid family biosynthetic process <extra_id_1> Chloroplast ### Plasma membrane <extra_id_2>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [molecular_function] <extra_id_2> [sequence] LGALGCVFPELLSGNGVKFGYA
<extra_id_0> Photosystem i ### Chloroplast thylakoid membrane ### Photosystem ii <extra_id_1> Photosynthesis <extra_id_2> Metal ion binding ### Chlorophyll binding <extra_id_3>
[biological_process] <extra_id_0> [sequence] SYEQYFGPGTRLTVT
<extra_id_0> Adaptive immune response <extra_id_1>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] WTFGQGTKVEIK
<extra_id_0> Adaptive immune response <extra_id_1> Immunoglobulin complex ### Extracellular region ### Plasma membrane <extra_id_2>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] GHGGASNYVRL
<extra_id_0> Extracellular region <extra_id_1> Neuropeptide signaling pathway <extra_id_2>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] SPVPEDDRGDNFVRL
<extra_id_0> Neuropeptide signaling pathway <extra_id_1> Extracellular region <extra_id_2>
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] DLPSGWSSYEGH
<extra_id_0> Toxin activity <extra_id_1> Extracellular region <extra_id_2>
[molecular_function] <extra_id_0> [sequence] GLEETYCSMRIKENI
<extra_id_0> Nutrient reservoir activity <extra_id_1>
[cellular_component] <extra_id_0> [sequence] SKVENIVDELKTLTL
<extra_id_0> Chloroplast ### Ribosome ### Ribonucleoprotein complex <extra_id_1>
[cellular_component] <extra_id_0> [sequence] SDAVADGVHAISGVVDS
<extra_id_0> Extracellular region <extra_id_1>
[cellular_component] <extra_id_0> [sequence] EHDPSAPGNGYC
<extra_id_0> Plasma membrane <extra_id_1>
[biological_process] <extra_id_0> [sequence] MNNSCLSQSTQWWWRAN
<extra_id_0> Tryptophan biosynthetic process <extra_id_1>
[cellular_component] <extra_id_0> [sequence] MTPRGFSCLLLPTSETDLPVKRRT
<extra_id_0> Cytoplasm ### Extracellular region <extra_id_1>
[cellular_component] <extra_id_0> [sequence] MTTRGFSCLLLLIREIDLSAKRRI
<extra_id_0> Cytoplasm ### Extracellular region <extra_id_1>
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] DNSCTPKPSCFF
<extra_id_0> Extracellular region <extra_id_1> Toxin activity <extra_id_2>
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [biological_process] <extra_id_2> [sequence] TPEHQRYVELFIVVD
<extra_id_0> Extracellular region <extra_id_1> Toxin activity ### Metal ion binding ### Metallopeptidase activity <extra_id_2> Proteolysis <extra_id_3>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] QASTDYDDEDESTVPEAR
<extra_id_0> Blood coagulation <extra_id_1> Extracellular region <extra_id_2>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] GDVQEGEFIAEGGGVR
<extra_id_0> Adaptive immune response ### Innate immune response ### Blood coagulation <extra_id_1> Extracellular region <extra_id_2>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] ALIFATLSAAYIGEALE
<extra_id_0> Proton transmembrane transport <extra_id_1> Chloroplast thylakoid membrane ### Proton-transporting atp synthase complex, coupling factor f(o) <extra_id_2>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] GVLSNVIGYLKKLGTGALNAVLKQ
<extra_id_0> Defense response to bacterium <extra_id_1> Extracellular region <extra_id_2>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] GLGNNAFVGVR
<extra_id_0> Extracellular region <extra_id_1> Neuropeptide signaling pathway <extra_id_2>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] MVELKFLIAFFLAFTAGILAIKLGQALYDC
<extra_id_0> Photosynthesis <extra_id_1> Photosystem i ### Chloroplast thylakoid membrane <extra_id_2>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] ILGLLKGISALLS
<extra_id_0> Extracellular region <extra_id_1> Chemotaxis <extra_id_2>
[biological_process] <extra_id_0> [sequence] LQYIERLDPEREPGRLTFIVRMGADKIRDKLPELVERSPPPATVAWITDPMHGNTYEAAPVHKTRRFDDVLDEVKGFFEVHKSLGTHPGGIHVELTGDDVTECVGGGDEIFVDDLHQRYETACDPRLNRSQSLDLAFLVAEMYRDQ
<extra_id_0> Amino acid biosynthetic process ### Chorismate biosynthetic process ### Aromatic amino acid family biosynthetic process <extra_id_1>
[molecular_function] <extra_id_0> [sequence] XGESWETPETGDEVE
<extra_id_0> Calmodulin binding ### Rna polymerase ii ctd heptapeptide repeat p3 isomerase activity ### Rna polymerase ii ctd heptapeptide repeat p6 isomerase activity <extra_id_1>
[biological_process] <extra_id_0> [sequence] TDPLWQLPGAHLEQYLS
<extra_id_0> Neuropeptide signaling pathway <extra_id_1>
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [biological_process] <extra_id_2> [sequence] SSEAAPEEKVAILGA
<extra_id_0> Mitochondrial matrix <extra_id_1> L-malate dehydrogenase (nad+) activity <extra_id_2> Tricarboxylic acid cycle <extra_id_3>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] HDVYGGDYRITGDDGHS
<extra_id_0> Methionine biosynthetic process <extra_id_1> Cytoplasm <extra_id_2>
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [sequence] AFQLDTNLVESLQK
<extra_id_0> Metal ion binding <extra_id_1> Apoplast <extra_id_2>
[molecular_function] <extra_id_0> [cellular_component] <extra_id_1> [biological_process] <extra_id_2> [sequence] ELVTLSGAHTIGQAR
<extra_id_0> Metal ion binding ### Heme binding <extra_id_1> Extracellular region <extra_id_2> Hydrogen peroxide catabolic process ### Response to oxidative stress <extra_id_3>
[cellular_component] <extra_id_0> [sequence] FLSALLGMLKNL
<extra_id_0> Extracellular region <extra_id_1>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [sequence] WFDPLRITETTTGSVTLK
<extra_id_0> L-arginine biosynthetic process <extra_id_1> Chloroplast <extra_id_2> Atp binding ### Argininosuccinate synthase activity <extra_id_3>
[biological_process] <extra_id_0> [sequence] QGIGVGDNDGKRGKR
<extra_id_0> Defense response to fungus ### Killing of cells of another organism <extra_id_1>
[biological_process] <extra_id_0> [sequence] MRNISLTTTIITTTDTTGNGAG
<extra_id_0> Threonine biosynthetic process <extra_id_1>
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [sequence] GHNKKDKKMQKK
<extra_id_0> Ribonucleoprotein complex ### Ribosome <extra_id_1> Rrna binding <extra_id_2>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [family] <extra_id_2> [sequence] MWTVQNRESLGLLSFPVMIAMVCCAHSANEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGAGKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTGVGDPKTTMYSYDSASIQYRKPMSSREGYGRALDRHGAHSKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH
<extra_id_0> Chloride transmembrane transport ### Monoatomic ion transport <extra_id_1> Postsynaptic membrane ### Gaba-ergic synapse ### Chloride channel complex ### Plasma membrane ### Schaffer collateral - ca1 synapse ### Synapse ### Neuron projection <extra_id_2> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_3>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] ILGTILGLLKSL
<extra_id_0> Extracellular region ### Membrane ### Other organism cell membrane <extra_id_1> Defense response to gram-positive bacterium ### Innate immune response ### Chemotaxis ### Defense response to gram-negative bacterium <extra_id_2>
[molecular_function] <extra_id_0> [biological_process] <extra_id_1> [family] <extra_id_2> [cellular_component] <extra_id_3> [sequence] RVRKKDYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTTACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFWRNALERHVAQKKSRLRERASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
<extra_id_0> Chloride channel activity <extra_id_1> Chloride transmembrane transport <extra_id_2> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_3> Chloride channel complex ### Cytoplasmic vesicle membrane ### Plasma membrane ### Synapse ### Neuron projection <extra_id_4>
[family] <extra_id_0> [sequence] MWTVQNRESLGLLSFPVMVAMVCCAHSSNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTGVSDPKATMYSYDSASIQYRKPLSSREGFGRGLDRHGVPGKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH
<extra_id_0> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_1>
[family] <extra_id_0> [sequence] MWTVQNRESLGLLSFPVMITMVCCAHSTNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDRHGVPSKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH
<extra_id_0> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_1>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [family] <extra_id_2> [sequence] MWGFGGGRIFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYAGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDNAVTGVERIELPQFSIVEYRLVSKNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGKGPQRQKKLAEKSAKANNDRSRFEGSRVDTHGNILLTSLEIHNEVASNEVTTSVTDARNSTISFDNSGIQYRKQSSHRESLGRRSSDRTGSHSKRGHLRRRSSQLKIKIPDLTDVNAIDRWSRMVFPFTFSLFNLIYWLYYVN
<extra_id_0> Chloride channel complex ### Cytoplasmic vesicle membrane ### Plasma membrane ### Synapse ### Neuron projection <extra_id_1> Chloride transmembrane transport <extra_id_2> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_3>
[biological_process] <extra_id_0> [family] <extra_id_1> [molecular_function] <extra_id_2> [cellular_component] <extra_id_3> [sequence] MWTFQADRLSGIVSALAALCVACCAQSPSTGNISVVKEIVDKLLKGYDVRLRPDFGGNPVTVGMSIHISSIDQISEVNMDYTITMYFQQSWRDKRLAYNDLPLNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDQQNCTLEIESYGYTVDDIVFFWQGNDSAVTGMEVLELPQFTIIEQRLVSREVVFTTGSYLRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYIFFGRGPRQQKKQSERISKANNERHRYEEKRVREQVDPYGNILLSTLDMNNELLATDMMSSVGDSRNSVMSFEGSGIQFRKPLASRDGFGHHPTLDRHVPLTHHAAARNRANCRLRRRSSKLKLKIPDLTDVSTIDKWSRIIFPITFGFFNLVYWLYYVN
<extra_id_0> Chloride transmembrane transport <extra_id_1> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_2> Chloride channel activity <extra_id_3> Postsynaptic membrane ### Chloride channel complex ### Plasma membrane ### Synapse ### Neuron projection <extra_id_4>
[family] <extra_id_0> [sequence] MWGLAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN
<extra_id_0> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_1>
[family] <extra_id_0> [sequence] MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
<extra_id_0> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_1>
[cellular_component] <extra_id_0> [family] <extra_id_1> [biological_process] <extra_id_2> [sequence] MWTVQNRESLGLLSFPVMVAMVCCAHSSNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNRLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTGVSDPKATMYSYDSASIQYRKPLSSREGFGRGLDRHGVPGKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH
<extra_id_0> Nuclear envelope ### Dendrite ### Gaba-ergic synapse ### Chloride channel complex ### Plasma membrane ### Schaffer collateral - ca1 synapse <extra_id_1> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_2> Response to toxic substance ### Monoatomic ion transport <extra_id_3>
[family] <extra_id_0> [sequence] MWGFAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSEINRVDAHGNILLAPMDVHNEMNEVAGSVGDTRNSAISFDNSGIQYRKQSMPKEGHGRYMGDRSIPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN
<extra_id_0> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_1>
[family] <extra_id_0> [sequence] MWGFAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSEINRVDAHGNILLAPMDVHNEMNEVAGSVGDTRNSAISFDNSGIQYRKQSMPKEGHGRYMGDRSIPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN
<extra_id_0> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_1>
[family] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [biological_process] <extra_id_3> [sequence] MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAANANNEKMRLDVNKMFYKDIKQNGTQYRSLWDPTGDLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
<extra_id_0> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_1> Dendritic spine ### Gaba-ergic synapse ### Chloride channel complex ### Plasma membrane ### Cytoplasmic vesicle <extra_id_2> Chloride channel activity <extra_id_3> Neuron development ### Chloride transmembrane transport <extra_id_4>
[family] <extra_id_0> [sequence] MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAANANNEKMRLDVNKMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
<extra_id_0> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_1>
[cellular_component] <extra_id_0> [family] <extra_id_1> [biological_process] <extra_id_2> [sequence] MTCFTRVGVSCGLFFFLLGAQLQLIRCIRKDVLAGRLENVTQTISNILQGYDIRLRPNFGGEPLHVGMDLTIASFDAISEVNMDYTITMYLNQYWRDERLAFNIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLVRLGGDGAVTYGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKPTPVRGVEDAELPQFTIIGYETNDRKERLATGVYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNYTYWGKRAKKKIKKVKECCPGKIGKSERSETCSTTEDIIELQDVRMSPIPSLRRGTYNATLDSIGTETMNLGKFPPSFRITRNYGTGHSQLRRRAQRGISTRPRMLHALKRGASAIKATIPKIKDVNIIDKYSRMIFPISFLAFNLGYWLFYILE
<extra_id_0> Postsynaptic membrane ### Chloride channel complex ### Plasma membrane ### Synapse ### Neuron projection <extra_id_1> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_2> Chloride transmembrane transport <extra_id_3>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] MSHDLDPTGTY
<extra_id_0> Actin filament organization <extra_id_1> Cytoplasm ### Nucleus <extra_id_2>
[cellular_component] <extra_id_0> [molecular_function] <extra_id_1> [biological_process] <extra_id_2> [sequence] INWKALLDAAKKVL
<extra_id_0> Extracellular region ### Membrane ### Other organism cell membrane <extra_id_1> Toxin activity <extra_id_2> Defense response to bacterium ### Innate immune response <extra_id_3>
[cellular_component] <extra_id_0> [family] <extra_id_1> [molecular_function] <extra_id_2> [sequence] MWGIIVPFFSASLMCSLVAVVRCQQDTDHFANVTNTIDSLLKGYDIRLRPSFGGAPLEIGIEVILASFDSISEVDMDYTITMYLNQYWRDERLQFIFNESLDLGENRSVTTMTLTGAFAEKIWVPDTFLANDKNSFLHDITEKNKMVRLYGNGSLVYGMRFTTTLACMMDLHNYPLDHQECTVEIESYGYTMDDIVLYWLNDRGAVTGVEDVSLPQFSITNYATINKIEELSTGDYQRLSLIFQLQRNIGYFIFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISNGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNYTYWGARAKRKAKRLRERATSVRKRVDDGDQMNNTNMDTVELKEVHMVPTSVGVTNSQSFNLDLDDGSGDDTGFRVVPPIPRSFTHSHATTHGYIPTNVVRRRSSSHVPPRRRRLLSHFRQKAKSIKVKIPRVQDVNTIDKYARLMFPLLFIIFNTSYWSVYLLT
<extra_id_0> Chloride channel complex ### Postsynaptic membrane <extra_id_1> Gamma-aminobutyric acid a receptor/glycine receptor alpha <extra_id_2> Chloride channel activity <extra_id_3>
[biological_process] <extra_id_0> [sequence] MTYQTAIDAVRELKA
<extra_id_0> Tricarboxylic acid cycle ### Glyoxylate cycle <extra_id_1>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [sequence] INWKKIASIGKEVLKAL
<extra_id_0> Defense response to bacterium ### Innate immune response <extra_id_1> Extracellular region ### Membrane ### Other organism cell membrane <extra_id_2> Toxin activity <extra_id_3>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [molecular_function] <extra_id_2> [sequence] TPDHQRYVELFIVVDHGMYTKYNGD
<extra_id_0> Proteolysis <extra_id_1> Extracellular region <extra_id_2> Peptidase activity ### Metal ion binding ### Toxin activity <extra_id_3>
[biological_process] <extra_id_0> [cellular_component] <extra_id_1> [sequence] AQRSPSLRLRF
<extra_id_0> Neuropeptide signaling pathway <extra_id_1> Extracellular region <extra_id_2>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] WEEYNIIXQLGNKGQ
<extra_id_0> Extracellular region <extra_id_1> Defense response to bacterium ### Killing of cells of another organism <extra_id_2>
[cellular_component] <extra_id_0> [biological_process] <extra_id_1> [sequence] LVALDTEFANR
<extra_id_0> Extracellular region <extra_id_1> Defense response to gram-positive bacterium <extra_id_2>
End of preview. Expand in Data Studio

No dataset card yet

Downloads last month
9