SentenceTransformer based on microsoft/mpnet-base

This is a sentence-transformers model finetuned from microsoft/mpnet-base. It maps sentences & paragraphs to a 768-dimensional dense vector space and can be used for semantic textual similarity, semantic search, paraphrase mining, text classification, clustering, and more.

Model Details

Model Description

  • Model Type: Sentence Transformer
  • Base model: microsoft/mpnet-base
  • Maximum Sequence Length: 512 tokens
  • Output Dimensionality: 768 dimensions
  • Similarity Function: Cosine Similarity

Model Sources

Full Model Architecture

SentenceTransformer(
  (0): Transformer({'max_seq_length': 512, 'do_lower_case': False}) with Transformer model: MPNetModel 
  (1): Pooling({'word_embedding_dimension': 768, 'pooling_mode_cls_token': False, 'pooling_mode_mean_tokens': True, 'pooling_mode_max_tokens': False, 'pooling_mode_mean_sqrt_len_tokens': False, 'pooling_mode_weightedmean_tokens': False, 'pooling_mode_lasttoken': False, 'include_prompt': True})
)

Usage

Direct Usage (Sentence Transformers)

First install the Sentence Transformers library:

pip install -U sentence-transformers

Then you can load this model and run inference.

from sentence_transformers import SentenceTransformer

# Download from the 🤗 Hub
model = SentenceTransformer("Chandar/sv-subject-based-matryoshka-mpnet-base")
# Run inference
sentences = [
    'channels. Cl- ions enter the cell and hyperpolarizes the membrane, making the neuron less likely to fire\nan action potential.\nOnce neurotransmission has occurred, the neurotransmitter must be removed from the synaptic\ncleft so the postsynaptic membrane can “reset” and be ready to receive another signal. This can be\naccomplished in three ways: the neurotransmitter can diffuse away from the synaptic cleft, it can be\ndegraded by enzymes in the synaptic cleft, or it can be recycled (sometimes called reuptake) by the\npresynaptic neuron. Several drugs act at this step of neurotransmission. For example, some drugs that\nare given to Alzheimer’s patients work by inhibiting acetylcholinesterase, the enzyme that degrades\nacetylcholine. This inhibition of the enzyme essentially increases neurotransmission at synapses that\nrelease acetylcholine. Once released, the acetylcholine stays in the cleft and can continually bind and\nunbind to postsynaptic receptors.\nNeurotransmitter Function and Location\nNeurotransmitter Example Location\nAcetylcholine — CNS and/or\nPNS\nBiogenic amine Dopamine, serotonin, norepinephrine CNS and/or\nPNS\nAmino acid Glycine, glutamate, aspartate, gamma aminobutyric\nacidCNS\nNeuropeptide Substance P, endorphins CNS and/or\nPNS\nTable 35.2\nElectrical Synapse\nWhile electrical synapses are fewer in number than chemical synapses, they are found in all nervous\nsystems and play important and unique roles. The mode of neurotransmission in electrical synapses is\nquite different from that in chemical synapses. In an electrical synapse, the presynaptic and postsynaptic\nmembranes are very close together and are actually physically connected by channel proteins forming\ngap junctions. Gap junctions allow current to pass directly from one cell to the next. In addition to the\nions that carry this current, other molecules, such as ATP, can diffuse through the large gap junction\npores.\nThere are key differences between chemical and electrical synapses. Because chemical synapses\ndepend on the release of neurotransmitter molecules from synaptic vesicles to pass on their signal, there\nis an approximately one millisecond delay between when the axon potential reaches the presynaptic\nterminal and when the neurotransmitter leads to opening of postsynaptic ion channels. Additionally, this\nsignaling is unidirectional. Signaling in electrical synapses, in contrast, is virtually instantaneous (which\nis important for synapses involved in key reflexes), and some electrical synapses are bidirectional.\nElectrical synapses are also more reliable as they are less likely to be blocked, and they are important\nfor synchronizing the electrical activity of a group of neurons. For example, electrical synapses in the\nthalamus are thought to regulate slow-wave sleep, and disruption of these synapses can cause seizures.\nSignal Summation\nSometimes a single EPSP is strong enough to induce an action potential in the postsynaptic neuron,\nbut often multiple presynaptic inputs must create EPSPs around the same time for the postsynaptic\nneuron to be sufficiently depolarized to fire an action potential. This process is calledsummation and\noccurs at the axon hillock, as illustrated inFigure 35.16. Additionally, one neuron often has inputs\nfrom many presynaptic neurons—some excitatory and some inhibitory—so IPSPs can cancel out EPSPs\nand vice versa. It is the net change in postsynaptic membrane voltage that determines whether the\npostsynaptic cell has reached its threshold of excitation needed to fire an action potential. Together,\nsynaptic summation and the threshold for excitation act as a filter so that random “noise” in the system\nis not transmitted as important information.\n1004 CHAPTER 35 | THE NERVOUS SYSTEM\nThis content is available for free at http://cnx.org/content/col11448/1.9',
    'WHERESELENIUMPOISONING\nIncertainportionsoftheNorthCentralgreatplains,plantsabsorbenoughsele-niumfromthesoiltoinjureanimalsthatfeeduponthem.Thepoisoningmayresultinaslowdiseaseknownas"blindstaggers"oras"alkalidisease",oritmaybequicklyfatal.Asaresultoftheselenium,thejointsoftheleg-bonesbecomebadlyeroded.Thehoofsdevelopabnormalitiesordropoff.Locomotionisimpaired.Theeffectoftheseleniumper-sists,fortheanimalsdonotusuallyrecoverevenifre-movedfromsucharegionandfedagoodrationOCCURSironisanessentialconstituentofthehemoglobin(seepage205).Coppercompoundsaregenerallypoisonoustomostkindsofprotoplasm;yetforsomespeciescopperisnecessaryinsmallamounts.Copperisanessentialelementinthebluishoxygen-carrierhemocyaninofthekingcrabandthelobster.InsomeoftheWesternstatesthesoilcontainstheelementselenium.Thiselementispresentalsoinplantsgrowinginsuchsoil,althoughitdoesnotappeartoaffecttheminanyway.Butanimalsthatfeeduponsuchplantsareoftenseriouslypoisoned(seeillustrationopposite).Inotherregionsvariationintheamountoffluorineinthesoilmaybeimportanttous.Theelementfluorine,whichisverywidelybutunevenlydistributed,seemstoplayaroleintheassimilationofcalciumandphosphorus,andsoaffectstheformationoftheteeth.Astudyof7000girlsandboysofhigh-schoolageinvariousmiddleandsouthwesternstatesbroughtoutthefactthattherewasmuchmoretoothdecay,orcaries^incommunitieswhosewatersupplieswerefreeoffluorinethanincommunitiesusingwaterwith0.5ormorepartsfluorinepermillionpartswater.Thus,thepopulationofacertainpartofTexas,DeafSmithCounty,wasfoundtohaveanexceptionallylownumberofdecayedteeth;andthisrelativefreedomfromdentalcariesisasso-ciatedwithmorethanusualamountsoffluorineinthelocalwaters.Inotherregionsunusualamountsoffluorineinthesoilandsoilwatersapparentlybringaboutthedevelopmentof"mottledteeth"amongthechildrenlivingthere.Nobodywantsblotchyteeth,butnobodywantscaries102',
    "INDEX 275\nSenescence\n1\n, 27-30,46,7078\ntheoiietiof,43f>0\nSenilechangesinneivecells,27-29\nSenilityat,causeofdeath,1011\ninplants,44,71,75\nSepiK.rniia,231,282\nSeitna,252,258\nMeium,influenceontissuecultme,\n70,77\nSe\\organs,107,IOS,111,121-125,\n217219\nSexualiepioduction,3741\nShell,J, 20,27\nSkeletalsyhtem,107,108,112,127,\n128\nskin,107,H)8,no,112,331,132\nSlonakei,,T I?,212,213,218,228,\n2U7\nSloiopolhki,B, 33,2(>7\nSnow,12 C,179-383,225,267\nSofteningofthe-hiain,231,2.12\nSoma,40\nSomaticcella,ranmntalityof,5878\nSpan,174,175\nSpiegelberg,W, 87\nSpmtuahsm,18-20\nSpleen,61\nSponges,62\nStatine,174,175\nStomach,M,217-210,207\nStenuntomum,35,36\nSievenflon,THC.,206-208,2(>7\nStillbirths,205\n$ ongyloocnt')otuspitrpmnIus,55,\n56\nHummaiyofreaultH,223-227\nf-hxi'vivorfiluplinesofDrosophilo,\n188,192,195\nSyphihH,123\nTable,life,70-82\nTempeiatuic,208-217\nTethehn,70,220222\nTbeoiiesofdeath,4350\nTheoiyofpopulationgiowtli,249\nThyioulgland,01\nTissuecnltmet Ditto,5878\nTianaplantationoftumois,04,(51\nTubeicuIomH,101,204,208,230,2!1,\n238\nTuiuoiti.uihpliinlation,61, 65\nTyphoidfcvei,230,2,11,2.J5,2,'iO\nUnitedStates,giowtliol,2502,12,\n254-257\nLi'iostylayiandis,72\nVanBuien,GII, 11J,2UO\nVariation,genetic,190\nVeneiwildiseases,123,124\nVeilmlHt,PF,249,2(57\nVerwoin,M,,44,207\nVienna,245,246\nVoumoll,217\nWallei,AD,216,207\nWalwoith,BH,152,267\nWar,243\nWedekmd,33,267\nWeiimann,A, 26,43,65,207\nWlialc,longevityof,22\nWilaon,HV,62,267\nWittalom,99\nWoodruff,LL,30,33,72,73,267,\n268\nWoodn,FA, 38,3,208\nYellowfever,240,21-2\nYoung,TTO,,23-25,268",
]
embeddings = model.encode(sentences)
print(embeddings.shape)
# [3, 768]

# Get the similarity scores for the embeddings
similarities = model.similarity(embeddings, embeddings)
print(similarities.shape)
# [3, 3]

Evaluation

Metrics

Binary Classification

Metric Value
cosine_accuracy 0.7608
cosine_accuracy_threshold 0.956
cosine_f1 0.5962
cosine_f1_threshold 0.9436
cosine_precision 0.5779
cosine_recall 0.6158
cosine_ap 0.6558
cosine_mcc 0.3892

Binary Classification

Metric Value
cosine_accuracy 0.7512
cosine_accuracy_threshold 0.9695
cosine_f1 0.5758
cosine_f1_threshold 0.96
cosine_precision 0.579
cosine_recall 0.5726
cosine_ap 0.6315
cosine_mcc 0.3695

Binary Classification

Metric Value
cosine_accuracy 0.7688
cosine_accuracy_threshold 0.8354
cosine_f1 0.6109
cosine_f1_threshold 0.7678
cosine_precision 0.5523
cosine_recall 0.6833
cosine_ap 0.6883
cosine_mcc 0.3938

Binary Classification

Metric Value
cosine_accuracy 0.755
cosine_accuracy_threshold 0.8873
cosine_f1 0.5923
cosine_f1_threshold 0.8024
cosine_precision 0.5241
cosine_recall 0.6809
cosine_ap 0.6656
cosine_mcc 0.3587

Binary Classification

Metric Value
cosine_accuracy 0.7398
cosine_accuracy_threshold 0.9206
cosine_f1 0.5858
cosine_f1_threshold 0.8388
cosine_precision 0.5022
cosine_recall 0.7027
cosine_ap 0.6336
cosine_mcc 0.3404

Binary Classification

Metric Value
cosine_accuracy 0.7362
cosine_accuracy_threshold 0.9587
cosine_f1 0.5954
cosine_f1_threshold 0.8968
cosine_precision 0.5004
cosine_recall 0.735
cosine_ap 0.6264
cosine_mcc 0.3528

Binary Classification

Metric Value
cosine_accuracy 0.7298
cosine_accuracy_threshold 0.9745
cosine_f1 0.5948
cosine_f1_threshold 0.929
cosine_precision 0.5095
cosine_recall 0.7143
cosine_ap 0.6023
cosine_mcc 0.3555

Binary Classification

Metric Value
cosine_accuracy 0.708
cosine_accuracy_threshold 0.9946
cosine_f1 0.518
cosine_f1_threshold 0.9767
cosine_precision 0.4194
cosine_recall 0.6772
cosine_ap 0.5203
cosine_mcc 0.2049

Binary Classification

Metric Value
cosine_accuracy 0.6796
cosine_accuracy_threshold 0.9989
cosine_f1 0.4953
cosine_f1_threshold -0.7454
cosine_precision 0.3291
cosine_recall 1.0
cosine_ap 0.4414
cosine_mcc 0.014

Binary Classification

Metric Value
cosine_accuracy 0.6728
cosine_accuracy_threshold 1.0
cosine_f1 0.4953
cosine_f1_threshold -0.7795
cosine_precision 0.3291
cosine_recall 1.0
cosine_ap 0.3823
cosine_mcc 0.014

Binary Classification

Metric Value
cosine_accuracy 0.6708
cosine_accuracy_threshold 1.0
cosine_f1 0.4953
cosine_f1_threshold -1.0
cosine_precision 0.3293
cosine_recall 0.9994
cosine_ap 0.3352
cosine_mcc 0.0

Training Details

Training Dataset

Unnamed Dataset

  • Size: 1,124,250 training samples
  • Columns: sentence1, sentence2, and label
  • Approximate statistics based on the first 1000 samples:
    sentence1 sentence2 label
    type string string int
    details
    • min: 512 tokens
    • mean: 512.0 tokens
    • max: 512 tokens
    • min: 23 tokens
    • mean: 432.19 tokens
    • max: 512 tokens
    • 0: ~50.10%
    • 1: ~49.90%
  • Samples:
    sentence1 sentence2 label
    channels. Cl- ions enter the cell and hyperpolarizes the membrane, making the neuron less likely to fire
    an action potential.
    Once neurotransmission has occurred, the neurotransmitter must be removed from the synaptic
    cleft so the postsynaptic membrane can “reset” and be ready to receive another signal. This can be
    accomplished in three ways: the neurotransmitter can diffuse away from the synaptic cleft, it can be
    degraded by enzymes in the synaptic cleft, or it can be recycled (sometimes called reuptake) by the
    presynaptic neuron. Several drugs act at this step of neurotransmission. For example, some drugs that
    are given to Alzheimer’s patients work by inhibiting acetylcholinesterase, the enzyme that degrades
    acetylcholine. This inhibition of the enzyme essentially increases neurotransmission at synapses that
    release acetylcholine. Once released, the acetylcholine stays in the cleft and can continually bind and
    unbind to postsynaptic receptors.
    Neurotransmitter Function and Location
    N...
    Figure 25.6 This table shows the major divisions of green plants.
    Which of the following statements about plant divisions is false?
    a. Lycophytes and pterophytes are seedless vascular plants.
    b. All vascular plants produce seeds.
    c. All nonvascular embryophytes are bryophytes.
    d. Seed plants include angiosperms and gymnosperms.
    25.2
    Green Algae: Precursors of Land Plants
    By the end of this section, you will be able to:
    • Describe the traits shared by green algae and land plants
    • Explain the reasons why Charales are considered the closest relative to land plants
    • Understand that current phylogenetic relationships are reshaped by comparative analysis of
    DNA sequences
    Streptophytes
    Until recently, all photosynthetic eukaryotes were considered members of the kingdom Plantae. The
    brown, red, and gold algae, however, have been reassigned to the Protista kingdom. This is because
    apart from their ability to capture light energy and fix CO2, they lack many structural and biochemical
    traits ...
    channels. Cl- ions enter the cell and hyperpolarizes the membrane, making the neuron less likely to fire
    an action potential.
    Once neurotransmission has occurred, the neurotransmitter must be removed from the synaptic
    cleft so the postsynaptic membrane can “reset” and be ready to receive another signal. This can be
    accomplished in three ways: the neurotransmitter can diffuse away from the synaptic cleft, it can be
    degraded by enzymes in the synaptic cleft, or it can be recycled (sometimes called reuptake) by the
    presynaptic neuron. Several drugs act at this step of neurotransmission. For example, some drugs that
    are given to Alzheimer’s patients work by inhibiting acetylcholinesterase, the enzyme that degrades
    acetylcholine. This inhibition of the enzyme essentially increases neurotransmission at synapses that
    release acetylcholine. Once released, the acetylcholine stays in the cleft and can continually bind and
    unbind to postsynaptic receptors.
    Neurotransmitter Function and Location
    N...
    NATURALDEATH,PUBLICHEALTH229
    andpublichealthhave,byallodds,thebestcasewhen
    measuredintermsofaccomplishment.Man'sexpecta-
    tionoflifehasincreasedashehascomedownthrough
    thecenturies(cf.PearsonandMacdonell.)Alarge
    partofthisimprovementmustsurelybecreditedtohis
    improvedunderstandingofhowtocopewithanalways
    moreorlessinimicalenvironmentandassuageitsasper-
    itiestohisgreatercomfortandwell-being.Tqfailto
    givethiscreditwouldbemanifestlyabsurd.
    Butitwouldbeequallyabsurdtoattempttomain-
    tainthatalldeclineinthedeath-ratewhichhasoccurred
    liasbeenduetotheeffortsofhealthofficials,whether
    consciousorunconscious,asisoftenassertedandstill
    moreoftenimpliedintheimpassionedoutpouringsof
    zealouspropagandists.Theopen-mindedstudentofthe
    naturalhistoryofdiseaseknqwsperfectlywellthata
    largepartoftheimprovementintherateofmortality
    cannotpossiblyhavebeenduetoanysuchefforts.To
    illustratethepoint,Ihavepreparedaseriesofillustra-
    tionsdealingwithconditionsintheEegistrationArea
    oftheUnitedStatesintheimmediatepast.Allthe...
    1
    channels. Cl- ions enter the cell and hyperpolarizes the membrane, making the neuron less likely to fire
    an action potential.
    Once neurotransmission has occurred, the neurotransmitter must be removed from the synaptic
    cleft so the postsynaptic membrane can “reset” and be ready to receive another signal. This can be
    accomplished in three ways: the neurotransmitter can diffuse away from the synaptic cleft, it can be
    degraded by enzymes in the synaptic cleft, or it can be recycled (sometimes called reuptake) by the
    presynaptic neuron. Several drugs act at this step of neurotransmission. For example, some drugs that
    are given to Alzheimer’s patients work by inhibiting acetylcholinesterase, the enzyme that degrades
    acetylcholine. This inhibition of the enzyme essentially increases neurotransmission at synapses that
    release acetylcholine. Once released, the acetylcholine stays in the cleft and can continually bind and
    unbind to postsynaptic receptors.
    Neurotransmitter Function and Location
    N...
    through a mass which is now formed out of sugar and is now dissolved again
    into sugar. For it appears that this soluble form of carbo-hydrate, taken into the
    liver from the intestine, is there, when not immediately needed, stored up in the
    form of glycogen, ready to be re-dissolved and carried into the system either for
    immediate use or for re-deposit as glycogen at the places where it is presently to
    be consumed: the great deposit in the liver and the minor deposits in the muscles
    being, to use the simile of Prof. Michael Foster, analogous in their functions to a
    central bank and branch banks.
    An instructive parallelism may be noted between these processes carried on in
    the animal organism and those carried on in the vegetal organism. For the carbo-
    hydrates named, easily made to assume the soluble or the insoluble form by the
    addition or subtraction of a molecule of water, and thus fitted sometimes for
    distribution and sometimes for accumulation, are similarly dealt with in the two
    c...
    1
  • Loss: MatryoshkaLoss with these parameters:
    {
        "loss": "CoSENTLoss",
        "matryoshka_dims": [
            768,
            512,
            256,
            128,
            64,
            32,
            16,
            8,
            4,
            2,
            1
        ],
        "matryoshka_weights": [
            1,
            1,
            1,
            1,
            1,
            1,
            1,
            1,
            1,
            1,
            1
        ],
        "n_dims_per_step": -1
    }
    

Training Hyperparameters

Non-Default Hyperparameters

  • per_device_train_batch_size: 16
  • per_device_eval_batch_size: 32
  • learning_rate: 2e-05
  • weight_decay: 0.01
  • max_steps: 2000

All Hyperparameters

Click to expand
  • overwrite_output_dir: False
  • do_predict: False
  • eval_strategy: no
  • prediction_loss_only: True
  • per_device_train_batch_size: 16
  • per_device_eval_batch_size: 32
  • per_gpu_train_batch_size: None
  • per_gpu_eval_batch_size: None
  • gradient_accumulation_steps: 1
  • eval_accumulation_steps: None
  • torch_empty_cache_steps: None
  • learning_rate: 2e-05
  • weight_decay: 0.01
  • adam_beta1: 0.9
  • adam_beta2: 0.999
  • adam_epsilon: 1e-08
  • max_grad_norm: 1.0
  • num_train_epochs: 3.0
  • max_steps: 2000
  • lr_scheduler_type: linear
  • lr_scheduler_kwargs: {}
  • warmup_ratio: 0.0
  • warmup_steps: 0
  • log_level: passive
  • log_level_replica: warning
  • log_on_each_node: True
  • logging_nan_inf_filter: True
  • save_safetensors: True
  • save_on_each_node: False
  • save_only_model: False
  • restore_callback_states_from_checkpoint: False
  • no_cuda: False
  • use_cpu: False
  • use_mps_device: False
  • seed: 42
  • data_seed: None
  • jit_mode_eval: False
  • use_ipex: False
  • bf16: False
  • fp16: False
  • fp16_opt_level: O1
  • half_precision_backend: auto
  • bf16_full_eval: False
  • fp16_full_eval: False
  • tf32: None
  • local_rank: 0
  • ddp_backend: None
  • tpu_num_cores: None
  • tpu_metrics_debug: False
  • debug: []
  • dataloader_drop_last: False
  • dataloader_num_workers: 0
  • dataloader_prefetch_factor: None
  • past_index: -1
  • disable_tqdm: False
  • remove_unused_columns: True
  • label_names: None
  • load_best_model_at_end: False
  • ignore_data_skip: False
  • fsdp: []
  • fsdp_min_num_params: 0
  • fsdp_config: {'min_num_params': 0, 'xla': False, 'xla_fsdp_v2': False, 'xla_fsdp_grad_ckpt': False}
  • fsdp_transformer_layer_cls_to_wrap: None
  • accelerator_config: {'split_batches': False, 'dispatch_batches': None, 'even_batches': True, 'use_seedable_sampler': True, 'non_blocking': False, 'gradient_accumulation_kwargs': None}
  • deepspeed: None
  • label_smoothing_factor: 0.0
  • optim: adamw_torch
  • optim_args: None
  • adafactor: False
  • group_by_length: False
  • length_column_name: length
  • ddp_find_unused_parameters: None
  • ddp_bucket_cap_mb: None
  • ddp_broadcast_buffers: False
  • dataloader_pin_memory: True
  • dataloader_persistent_workers: False
  • skip_memory_metrics: True
  • use_legacy_prediction_loop: False
  • push_to_hub: False
  • resume_from_checkpoint: None
  • hub_model_id: None
  • hub_strategy: every_save
  • hub_private_repo: None
  • hub_always_push: False
  • hub_revision: None
  • gradient_checkpointing: False
  • gradient_checkpointing_kwargs: None
  • include_inputs_for_metrics: False
  • include_for_metrics: []
  • eval_do_concat_batches: True
  • fp16_backend: auto
  • push_to_hub_model_id: None
  • push_to_hub_organization: None
  • mp_parameters:
  • auto_find_batch_size: False
  • full_determinism: False
  • torchdynamo: None
  • ray_scope: last
  • ddp_timeout: 1800
  • torch_compile: False
  • torch_compile_backend: None
  • torch_compile_mode: None
  • include_tokens_per_second: False
  • include_num_input_tokens_seen: False
  • neftune_noise_alpha: None
  • optim_target_modules: None
  • batch_eval_metrics: False
  • eval_on_start: False
  • use_liger_kernel: False
  • liger_kernel_config: None
  • eval_use_gather_object: False
  • average_tokens_across_devices: False
  • prompts: None
  • batch_sampler: batch_sampler
  • multi_dataset_batch_sampler: proportional

Training Logs

Epoch Step Training Loss cosine_ap
-1 -1 - 0.3352
0.0071 500 13.3939 -
0.0142 1000 3.2648 -
0.0213 1500 2.8893 -
0.0285 2000 2.9935 -

Framework Versions

  • Python: 3.12.9
  • Sentence Transformers: 4.1.0
  • Transformers: 4.53.0
  • PyTorch: 2.7.1
  • Accelerate: 1.8.1
  • Datasets: 3.6.0
  • Tokenizers: 0.21.2

Citation

BibTeX

Sentence Transformers

@inproceedings{reimers-2019-sentence-bert,
    title = "Sentence-BERT: Sentence Embeddings using Siamese BERT-Networks",
    author = "Reimers, Nils and Gurevych, Iryna",
    booktitle = "Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing",
    month = "11",
    year = "2019",
    publisher = "Association for Computational Linguistics",
    url = "https://arxiv.org/abs/1908.10084",
}

MatryoshkaLoss

@misc{kusupati2024matryoshka,
    title={Matryoshka Representation Learning},
    author={Aditya Kusupati and Gantavya Bhatt and Aniket Rege and Matthew Wallingford and Aditya Sinha and Vivek Ramanujan and William Howard-Snyder and Kaifeng Chen and Sham Kakade and Prateek Jain and Ali Farhadi},
    year={2024},
    eprint={2205.13147},
    archivePrefix={arXiv},
    primaryClass={cs.LG}
}

CoSENTLoss

@online{kexuefm-8847,
    title={CoSENT: A more efficient sentence vector scheme than Sentence-BERT},
    author={Su Jianlin},
    year={2022},
    month={Jan},
    url={https://kexue.fm/archives/8847},
}
Downloads last month
5
Safetensors
Model size
109M params
Tensor type
F32
·
Inference Providers NEW
This model isn't deployed by any Inference Provider. 🙋 Ask for provider support

Model tree for Chandar/sv-subject-based-matryoshka-mpnet-base

Finetuned
(87)
this model

Evaluation results