Spaces:
Runtime error
Runtime error
| import gradio as gr | |
| import torch | |
| from fuse.data.tokenizers.modular_tokenizer.op import ModularTokenizerOp | |
| from mammal.keys import ( | |
| CLS_PRED, | |
| ENCODER_INPUTS_ATTENTION_MASK, | |
| ENCODER_INPUTS_STR, | |
| ENCODER_INPUTS_TOKENS, | |
| SCORES, | |
| ) | |
| from mammal.model import Mammal | |
| from mammal_demo.demo_framework import MammalObjectBroker, MammalTask | |
| class TcrTask(MammalTask): | |
| def __init__(self, model_dict): | |
| super().__init__( | |
| name="T-cell receptors-peptide binding specificity", model_dict=model_dict | |
| ) | |
| self.description = "T-cell receptors-peptide binding specificity (TCR)" | |
| self.examples = { | |
| "tcr_beta_seq": "NAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYSWDRVLEQYFGPGTRLTVT", | |
| "epitope_seq": "LLQTGIHVRVSQPSL", | |
| } | |
| self.markup_text = """ | |
| # Mammal based T-cell receptors-peptide binding specificity demonstration | |
| Given the TCR beta sequance and the epitope sequacne, estimate the binding specificity. | |
| """ | |
| def create_prompt(self, tcr_beta_seq, epitope_seq): | |
| prompt = ( | |
| "<@TOKENIZER-TYPE=AA><BINDING_AFFINITY_CLASS><SENTINEL_ID_0>" | |
| + f"<@TOKENIZER-TYPE=AA><MOLECULAR_ENTITY><MOLECULAR_ENTITY_TCR_BETA_VDJ><SEQUENCE_NATURAL_START>{tcr_beta_seq}<SEQUENCE_NATURAL_END>" | |
| + f"<@TOKENIZER-TYPE=AA><MOLECULAR_ENTITY><MOLECULAR_ENTITY_EPITOPE><SEQUENCE_NATURAL_START>{epitope_seq}<SEQUENCE_NATURAL_END><EOS>" | |
| ) | |
| return prompt | |
| def crate_sample_dict(self, sample_inputs: dict, model_holder: MammalObjectBroker): | |
| """convert sample_inputs to sample_dict including creating a proper prompt | |
| Args: | |
| sample_inputs (dict): dictionary containing the inputs to the model | |
| model_holder (MammalObjectBroker): model holder | |
| Returns: | |
| dict: sample_dict for feeding into model | |
| """ | |
| sample_dict = dict() | |
| sample_dict[ENCODER_INPUTS_STR] = self.create_prompt(**sample_inputs) | |
| tokenizer_op = model_holder.tokenizer_op | |
| model = model_holder.model | |
| tokenizer_op( | |
| sample_dict=sample_dict, | |
| key_in=ENCODER_INPUTS_STR, | |
| key_out_tokens_ids=ENCODER_INPUTS_TOKENS, | |
| key_out_attention_mask=ENCODER_INPUTS_ATTENTION_MASK, | |
| ) | |
| sample_dict[ENCODER_INPUTS_TOKENS] = torch.tensor( | |
| sample_dict[ENCODER_INPUTS_TOKENS], device=model.device | |
| ) | |
| sample_dict[ENCODER_INPUTS_ATTENTION_MASK] = torch.tensor( | |
| sample_dict[ENCODER_INPUTS_ATTENTION_MASK], device=model.device | |
| ) | |
| return sample_dict | |
| def run_model(self, sample_dict, model: Mammal): | |
| # Generate Prediction | |
| batch_dict = model.generate( | |
| [sample_dict], | |
| output_scores=True, | |
| return_dict_in_generate=True, | |
| max_new_tokens=5, | |
| ) | |
| return batch_dict | |
| def positive_token_id(tokenizer_op: ModularTokenizerOp): | |
| """token for positive binding | |
| Args: | |
| model (MammalTrainedModel): model holding tokenizer | |
| Returns: | |
| int: id of positive binding token | |
| """ | |
| return tokenizer_op.get_token_id("<1>") | |
| def negative_token_id(tokenizer_op: ModularTokenizerOp): | |
| """token for negative binding | |
| Args: | |
| model (MammalTrainedModel): model holding tokenizer | |
| Returns: | |
| int: id of negative binding token | |
| """ | |
| return tokenizer_op.get_token_id("<0>") | |
| def decode_output(self, batch_dict, tokenizer_op: ModularTokenizerOp) -> list: | |
| """ | |
| Extract predicted class and scores | |
| """ | |
| # positive_token_id = self.positive_token_id(tokenizer_op) | |
| # negative_token_id = self.negative_token_id(tokenizer_op) | |
| negative_token_id = tokenizer_op.get_token_id("<0>") | |
| positive_token_id = tokenizer_op.get_token_id("<1>") | |
| label_id_to_int = { | |
| negative_token_id: 0, | |
| positive_token_id: 1, | |
| } | |
| classification_position = 1 | |
| decoder_output = batch_dict[CLS_PRED][0] | |
| decoder_output_scores = batch_dict[SCORES][0] | |
| if decoder_output_scores is not None: | |
| scores = decoder_output_scores[classification_position, positive_token_id] | |
| else: | |
| scores = [None] | |
| ans = [ | |
| tokenizer_op._tokenizer.decode(batch_dict[CLS_PRED][0]), | |
| label_id_to_int.get(int(decoder_output[classification_position]), -1), | |
| scores.item(), | |
| ] | |
| return ans | |
| def create_and_run_prompt(self, model_name, tcr_beta_seq, epitope_seq): | |
| model_holder = self.model_dict[model_name] | |
| inputs = { | |
| "tcr_beta_seq": tcr_beta_seq, | |
| "epitope_seq": epitope_seq, | |
| } | |
| sample_dict = self.crate_sample_dict( | |
| sample_inputs=inputs, model_holder=model_holder | |
| ) | |
| prompt = sample_dict[ENCODER_INPUTS_STR] | |
| batch_dict = self.run_model(sample_dict=sample_dict, model=model_holder.model) | |
| res = prompt, *self.decode_output( | |
| batch_dict, tokenizer_op=model_holder.tokenizer_op | |
| ) | |
| return res | |
| def create_demo(self, model_name_widget): | |
| with gr.Group() as demo: | |
| gr.Markdown(self.markup_text) | |
| with gr.Row(): | |
| tcr_textbox = gr.Textbox( | |
| label="T-cell receptor beta sequence", | |
| # info="standard", | |
| interactive=True, | |
| lines=3, | |
| value=self.examples["tcr_beta_seq"], | |
| ) | |
| epitope_textbox = gr.Textbox( | |
| label="Epitope sequace", | |
| # info="standard", | |
| interactive=True, | |
| lines=3, | |
| value=self.examples["epitope_seq"], | |
| ) | |
| with gr.Row(): | |
| run_mammal = gr.Button( | |
| "Run Mammal prompt for TCL-Epitope Interaction", | |
| variant="primary", | |
| ) | |
| with gr.Row(): | |
| prompt_box = gr.Textbox(label="Mammal prompt", lines=5) | |
| with gr.Row(): | |
| decoded = gr.Textbox(label="Mammal output") | |
| predicted_class = gr.Textbox(label="Mammal prediction") | |
| binding_score = gr.Number(label="Binding score") | |
| run_mammal.click( | |
| fn=self.create_and_run_prompt, | |
| inputs=[model_name_widget, tcr_textbox, epitope_textbox], | |
| outputs=[prompt_box, decoded, predicted_class, binding_score], | |
| ) | |
| demo.visible = False | |
| return demo | |