--- library_name: peft license: mit datasets: - AmelieSchreiber/binding_sites_random_split_by_family_550K language: - en metrics: - accuracy - precision - recall - f1 - roc_auc - matthews_correlation pipeline_tag: token-classification tags: - ESM-2 - biology - protein language model - binding sites --- # ESM-2 for Binding Site Prediction This model *may be* close to SOTA compared to [these SOTA structural models](https://www.biorxiv.org/content/10.1101/2023.08.11.553028v1). One of the primary goals in training this model is to prove the viability of using simple, single sequence only protein language models for binary token classification tasks like predicting binding and active sites of protein sequences based on sequence alone. This project is also an attempt to make deep learning techniques like LoRA more accessible and to showcase the competative or even superior performance of simple models and techniques. Moreover, since most proteins still do not have a predicted 3D fold or backbone structure, it is useful to have a model that can predict binding residues from sequence alone. We also hope that this project will be helpful in this regard. It has been shown that pLMs like ESM-2 contain structural information in the attention maps that recapitulate the contact maps of proteins, and that single sequence masked language models like ESMFold can be used in atomically accurate predictions of folds, even outperforming AlphaFold2 on proteins up to about 400 residues long. In our approach we show a positive correlation between scaling the model size and data in a 1-to-1 fashion provides competative and possibly even SOTA performance, although our comparison to the SOTA models is not as fair and comprehensive as it could be (see [this report for more details](https://api.wandb.ai/links/amelie-schreiber-math/0asqd3hs)). This model is a finetuned version of the 35M parameter `esm2_t12_35M_UR50D` ([see here](https://huggingface.co/facebook/esm2_t12_35M_UR50D) and [here](https://huggingface.co/docs/transformers/model_doc/esm) for more details). The model was finetuned with LoRA for the binay token classification task of predicting binding sites (and active sites) of protein sequences based on sequence alone. The model may need more training, however it still achieves better performance on the test set in terms of loss, accuracy, precision, recall, F1 score, ROC_AUC, and Matthews Correlation Coefficient (MCC) compared to the models trained on the smaller dataset [found here](https://huggingface.co/datasets/AmelieSchreiber/binding_sites_random_split_by_family) of ~209K protein sequences. Note, this model has a high recall, meaning it is likely to detect binding sites, but it has a precision score that is somewhat lower than the SOTA structural models mentioned above, meaning the model may return some false positives as well. ## Running Inference You can download and run [this notebook](https://huggingface.co/AmelieSchreiber/esm2_t12_35M_lora_binding_sites_v2_cp3/blob/main/testing_and_inference.ipynb) to test out any of the ESMB models. Note, if you would like to run the models on the train/test split to get the metrics, you may need to do locally or in a Colab Pro instance as the datasets are quite large and will not run in a standard Colab (you can still run inference on your own protein sequences though). ## Training procedure This model was finetuned with LoRA on ~549K protein sequences from the UniProt database. The dataset can be found [here](https://huggingface.co/datasets/AmelieSchreiber/binding_sites_random_split_by_family_550K). The model obtains the following test metrics: ```python Epoch: 3 Training Loss: 0.029100 Validation Loss: 0.291670 Accuracy: 0.948626 Precision: 0.409795 Recall: 0.826979 F1: 0.548025 Auc: 0.890183 Mcc: 0.560612 ``` ### Framework versions - PEFT 0.5.0 ## Using the model To use the model on one of your protein sequences try running the following: ```python !pip install transformers -q !pip install peft -q ``` ```python from transformers import AutoModelForTokenClassification, AutoTokenizer from peft import PeftModel import torch # Path to the saved LoRA model model_path = "AmelieSchreiber/esm2_t12_35M_lora_binding_sites_v2_cp3" # ESM2 base model base_model_path = "facebook/esm2_t12_35M_UR50D" # Load the model base_model = AutoModelForTokenClassification.from_pretrained(base_model_path) loaded_model = PeftModel.from_pretrained(base_model, model_path) # Ensure the model is in evaluation mode loaded_model.eval() # Load the tokenizer loaded_tokenizer = AutoTokenizer.from_pretrained(base_model_path) # Protein sequence for inference protein_sequence = "MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT" # Replace with your actual sequence # Tokenize the sequence inputs = loaded_tokenizer(protein_sequence, return_tensors="pt", truncation=True, max_length=1024, padding='max_length') # Run the model with torch.no_grad(): logits = loaded_model(**inputs).logits # Get predictions tokens = loaded_tokenizer.convert_ids_to_tokens(inputs["input_ids"][0]) # Convert input ids back to tokens predictions = torch.argmax(logits, dim=2) # Define labels id2label = { 0: "No binding site", 1: "Binding site" } # Print the predicted labels for each token for token, prediction in zip(tokens, predictions[0].numpy()): if token not in ['', '', '']: print((token, id2label[prediction])) ```