File size: 5,520 Bytes
ff2d02b bfb5168 ff2d02b b648b64 d56fafb 0612706 7cf9c57 0612706 b648b64 210a373 b648b64 40d957d b648b64 3db1969 ff2d02b 95d7464 b648b64 dc4b7ac ff2d02b b648b64 65808d9 b648b64 ff2d02b b648b64 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 |
---
library_name: peft
license: mit
datasets:
- AmelieSchreiber/binding_sites_random_split_by_family_550K
language:
- en
metrics:
- accuracy
- precision
- recall
- f1
- roc_auc
- matthews_correlation
pipeline_tag: token-classification
tags:
- ESM-2
- biology
- protein language model
- binding sites
---
# ESM-2 for Binding Site Prediction
This model *may be* close to SOTA compared to [these SOTA structural models](https://www.biorxiv.org/content/10.1101/2023.08.11.553028v1).
One of the primary goals in training this model is to prove the viability of using simple, single sequence only protein language models
for binary token classification tasks like predicting binding and active sites of protein sequences based on sequence alone. This project
is also an attempt to make deep learning techniques like LoRA more accessible and to showcase the competative or even superior performance
of simple models and techniques. Moreover, since most proteins still do not have a predicted 3D fold or backbone structure, it is useful to
have a model that can predict binding residues from sequence alone. We also hope that this project will be helpful in this regard.
It has been shown that pLMs like ESM-2 contain structural information in the attention maps that recapitulate the contact maps of proteins,
and that single sequence masked language models like ESMFold can be used in atomically accurate predictions of folds, even outperforming
AlphaFold2 on proteins up to about 400 residues long. In our approach we show a positive correlation between scaling the model size and data
in a 1-to-1 fashion provides competative and possibly even SOTA performance, although our comparison to the SOTA models is not as fair and
comprehensive as it could be (see [this report for more details](https://api.wandb.ai/links/amelie-schreiber-math/0asqd3hs)).
This model is a finetuned version of the 35M parameter `esm2_t12_35M_UR50D` ([see here](https://huggingface.co/facebook/esm2_t12_35M_UR50D)
and [here](https://huggingface.co/docs/transformers/model_doc/esm) for more details). The model was finetuned with LoRA for
the binay token classification task of predicting binding sites (and active sites) of protein sequences based on sequence alone.
The model may need more training, however it still achieves better performance on the test set in terms of loss, accuracy,
precision, recall, F1 score, ROC_AUC, and Matthews Correlation Coefficient (MCC) compared to the models trained on the smaller
dataset [found here](https://huggingface.co/datasets/AmelieSchreiber/binding_sites_random_split_by_family) of ~209K protein sequences. Note,
this model has a high recall, meaning it is likely to detect binding sites, but it has a precision score that is somewhat lower than the SOTA
structural models mentioned above, meaning the model may return some false positives as well.
## Running Inference
You can download and run [this notebook](https://huggingface.co/AmelieSchreiber/esm2_t12_35M_lora_binding_sites_v2_cp3/blob/main/testing_and_inference.ipynb)
to test out any of the ESMB models. Note, if you would like to run the models on the train/test split to get the metrics, you may need to do
locally or in a Colab Pro instance as the datasets are quite large and will not run in a standard Colab (you can still run inference on your own
protein sequences though).
## Training procedure
This model was finetuned with LoRA on ~549K protein sequences from the UniProt database. The dataset can be found
[here](https://huggingface.co/datasets/AmelieSchreiber/binding_sites_random_split_by_family_550K). The model obtains
the following test metrics:
```python
Epoch: 3
Training Loss: 0.029100
Validation Loss: 0.291670
Accuracy: 0.948626
Precision: 0.409795
Recall: 0.826979
F1: 0.548025
Auc: 0.890183
Mcc: 0.560612
```
### Framework versions
- PEFT 0.5.0
## Using the model
To use the model on one of your protein sequences try running the following:
```python
!pip install transformers -q
!pip install peft -q
```
```python
from transformers import AutoModelForTokenClassification, AutoTokenizer
from peft import PeftModel
import torch
# Path to the saved LoRA model
model_path = "AmelieSchreiber/esm2_t12_35M_lora_binding_sites_v2_cp3"
# ESM2 base model
base_model_path = "facebook/esm2_t12_35M_UR50D"
# Load the model
base_model = AutoModelForTokenClassification.from_pretrained(base_model_path)
loaded_model = PeftModel.from_pretrained(base_model, model_path)
# Ensure the model is in evaluation mode
loaded_model.eval()
# Load the tokenizer
loaded_tokenizer = AutoTokenizer.from_pretrained(base_model_path)
# Protein sequence for inference
protein_sequence = "MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT" # Replace with your actual sequence
# Tokenize the sequence
inputs = loaded_tokenizer(protein_sequence, return_tensors="pt", truncation=True, max_length=1024, padding='max_length')
# Run the model
with torch.no_grad():
logits = loaded_model(**inputs).logits
# Get predictions
tokens = loaded_tokenizer.convert_ids_to_tokens(inputs["input_ids"][0]) # Convert input ids back to tokens
predictions = torch.argmax(logits, dim=2)
# Define labels
id2label = {
0: "No binding site",
1: "Binding site"
}
# Print the predicted labels for each token
for token, prediction in zip(tokens, predictions[0].numpy()):
if token not in ['<pad>', '<cls>', '<eos>']:
print((token, id2label[prediction]))
``` |